mRNA_H-akashiwo_Contig837.6.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: J9KBW9_ACYPI (Uncharacterized protein n=1 Tax=Acyrthosiphon pisum TaxID=7029 RepID=J9KBW9_ACYPI) HSP 1 Score: 65.5 bits (158), Expect = 1.260e-10 Identity = 35/73 (47.95%), Postives = 50/73 (68.49%), Query Frame = 1 Query: 7 LYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNAQK 225 +YPNIK++LL++ LP + AER S LRRLK WLRS MGQ++L+ AL +R E +VD ++I+ R+ K Sbjct: 553 IYPNIKRLLLIIACLPISVASAERSFSTLRRLKTWLRSKMGQNRLSGLALLNIHR-EIEVDTQDIIQRFAKMK 624
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: A0A6G0VS68_APHCR (52 kDa repressor of the inhibitor of the protein kinase-like (Fragment) n=1 Tax=Aphis craccivora TaxID=307492 RepID=A0A6G0VS68_APHCR) HSP 1 Score: 65.5 bits (158), Expect = 1.260e-10 Identity = 34/74 (45.95%), Postives = 50/74 (67.57%), Query Frame = 1 Query: 4 ELYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNAQK 225 ++PNI K+L+++ LP + AER S LRRLK WLRST+G+++LN AL ++D +DIE I+ R+ QK Sbjct: 599 SIFPNINKMLIIICSLPISVATAERSFSTLRRLKTWLRSTIGEERLNGLALLHIHKDIP-IDIENIITRFAKQK 671
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: J9KCW5_ACYPI (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Acyrthosiphon pisum TaxID=7029 RepID=J9KCW5_ACYPI) HSP 1 Score: 64.7 bits (156), Expect = 1.890e-10 Identity = 35/74 (47.30%), Postives = 48/74 (64.86%), Query Frame = 1 Query: 4 ELYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNAQK 225 ++PNI +L ++ LP + AER S LRRLK WLRST G+D+LN AL +RD K+DI+ I+ R+ QK Sbjct: 245 SVFPNIHYILSIICSLPISVASAERSFSTLRRLKTWLRSTTGEDRLNGLALLHIHRDI-KIDIDNIITRFAKQK 317
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: UPI000B930CBD (52 kDa repressor of the inhibitor of the protein kinase-like n=1 Tax=Myzus persicae TaxID=13164 RepID=UPI000B930CBD) HSP 1 Score: 64.7 bits (156), Expect = 2.350e-10 Identity = 35/73 (47.95%), Postives = 49/73 (67.12%), Query Frame = 1 Query: 7 LYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNAQK 225 +YPNIK++LL++ LP + AER S LRRLK WLRS MGQ++L AL +R E ++D +EI+ R+ K Sbjct: 557 IYPNIKRLLLIIACLPISVASAERSFSTLRRLKTWLRSKMGQNRLCGLALLNIHR-EIEIDTQEIIQRFAKMK 628
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: UPI0011146580 (zinc finger MYM-type protein 1-like n=1 Tax=Acyrthosiphon pisum TaxID=7029 RepID=UPI0011146580) HSP 1 Score: 63.2 bits (152), Expect = 3.050e-10 Identity = 34/73 (46.58%), Postives = 48/73 (65.75%), Query Frame = 1 Query: 7 LYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNAQK 225 ++PNIKK+L ++ LP + AER S LRRLK WLRS MGQD+L AL Y+ E + ++EI+ R++ K Sbjct: 139 IFPNIKKLLGIMACLPISVASAERSFSTLRRLKTWLRSKMGQDRLCGLALLHIYQ-EINIPVDEIIERFSRMK 210
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: A0A8B8G8X5_9HEMI (zinc finger MYM-type protein 1-like n=1 Tax=Sipha flava TaxID=143950 RepID=A0A8B8G8X5_9HEMI) HSP 1 Score: 60.5 bits (145), Expect = 3.300e-10 Identity = 30/66 (45.45%), Postives = 45/66 (68.18%), Query Frame = 1 Query: 7 LYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEIL 204 LYPNIKK+L ++ LP + AER S +RRLK WLRS MG+++L AL +R + V+++E++ Sbjct: 15 LYPNIKKILHIIACLPVSVASAERSFSTIRRLKTWLRSNMGEERLVGLALLNIHR-HRTVEVDEVI 79
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: X1WQF9_ACYPI (Dimer_Tnp_hAT domain-containing protein n=2 Tax=Acyrthosiphon pisum TaxID=7029 RepID=X1WQF9_ACYPI) HSP 1 Score: 61.2 bits (147), Expect = 5.430e-10 Identity = 31/66 (46.97%), Postives = 45/66 (68.18%), Query Frame = 1 Query: 7 LYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEIL 204 LYPNIKK+L ++ LP + AER S LRRLK WLRS MG+++L AL +R + V+++E++ Sbjct: 78 LYPNIKKILHIIACLPVSVASAERSFSTLRRLKTWLRSNMGEERLVGLALLNIHR-HRTVEVDEVI 142
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: UPI000DC14573 (zinc finger MYM-type protein 1-like n=2 Tax=Aphidini TaxID=33387 RepID=UPI000DC14573) HSP 1 Score: 63.5 bits (153), Expect = 5.920e-10 Identity = 33/73 (45.21%), Postives = 49/73 (67.12%), Query Frame = 1 Query: 7 LYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNAQK 225 LYP +KK+L +L LP + AER S LRRLK WLRSTMGQ++L+ AL +R ++I++I+ +++ K Sbjct: 420 LYPTVKKLLFILACLPVSVASAERSFSTLRRLKTWLRSTMGQNRLSGLALLHVHRSIS-INIDKIIDKFSQMK 491
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: UPI000B935035 (zinc finger MYM-type protein 1-like n=1 Tax=Myzus persicae TaxID=13164 RepID=UPI000B935035) HSP 1 Score: 63.5 bits (153), Expect = 6.020e-10 Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 1 Query: 7 LYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNAQK 225 ++P I +LL+LG LP + AER S LRRLK WLRS MGQD+L AL +R E + +E I+ R+ + K Sbjct: 605 IFPTIHNILLILGTLPVSVATAERSFSTLRRLKTWLRSQMGQDRLVGLALLNVHR-EYNISVENIISRFASMK 676
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Match: UPI00201426D7 (52 kDa repressor of the inhibitor of the protein kinase-like n=2 Tax=Megalobrama amblycephala TaxID=75352 RepID=UPI00201426D7) HSP 1 Score: 63.2 bits (152), Expect = 8.210e-10 Identity = 33/73 (45.21%), Postives = 48/73 (65.75%), Query Frame = 1 Query: 1 MELYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACALAMAYRDEQKVDIEEILFRWNA 219 +E YPN+K +LL+ LP T ER S LRRLK WLRSTMG ++L++ AL +++ + +D +L RW+A Sbjct: 561 LEFYPNVKCMLLLFLTLPVTTCSCERSFSALRRLKTWLRSTMGDERLSSLALMHVHQNIE-IDPHRVLQRWDA 632 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig837.6.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig837.6.1 >prot_H-akashiwo_Contig837.6.1 ID=prot_H-akashiwo_Contig837.6.1|Name=mRNA_H-akashiwo_Contig837.6.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=79bp MELYPNIKKVLLVLGILPSHTSEAERVISLLRRLKPWLRSTMGQDKLNACback to top mRNA from alignment at H-akashiwo_Contig837:220693..220929+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig837.6.1 ID=mRNA_H-akashiwo_Contig837.6.1|Name=mRNA_H-akashiwo_Contig837.6.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=237bp|location=Sequence derived from alignment at H-akashiwo_Contig837:220693..220929+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig837:220693..220929+ >mRNA_H-akashiwo_Contig837.6.1 ID=mRNA_H-akashiwo_Contig837.6.1|Name=mRNA_H-akashiwo_Contig837.6.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=237bp|location=Sequence derived from alignment at H-akashiwo_Contig837:220693..220929+ (Heterosigma akashiwo CCMP452)back to top |