mRNA_H-akashiwo_Contig834.8.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig834.8.1 vs. uniprot
Match: A0A7S3Y5V9_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y5V9_HETAK) HSP 1 Score: 66.2 bits (160), Expect = 1.970e-11 Identity = 30/56 (53.57%), Postives = 45/56 (80.36%), Query Frame = 2 Query: 17 FMTVLVIISWLIMFFQEDGAAIYAVDFSLVLVFAAEVLWKSLAFGFRTGPRPFLKS 184 FMT++V++SWLIMF ++ G I ++ ++++F+AEVLWKS AFGF +GP+ FLKS Sbjct: 214 FMTLVVVVSWLIMFDEKGGTGIEILEIIIMILFSAEVLWKSTAFGFYSGPQAFLKS 269 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig834.8.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig834.8.1 >prot_H-akashiwo_Contig834.8.1 ID=prot_H-akashiwo_Contig834.8.1|Name=mRNA_H-akashiwo_Contig834.8.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=62bp QEDKQVHDSSSDYFMADYVFPGRWGCYICSRLFTGARLCSRGVVEKPCFWback to top mRNA from alignment at H-akashiwo_Contig834:404285..404967- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig834.8.1 ID=mRNA_H-akashiwo_Contig834.8.1|Name=mRNA_H-akashiwo_Contig834.8.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=683bp|location=Sequence derived from alignment at H-akashiwo_Contig834:404285..404967- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig834:404285..404967- >mRNA_H-akashiwo_Contig834.8.1 ID=mRNA_H-akashiwo_Contig834.8.1|Name=mRNA_H-akashiwo_Contig834.8.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=186bp|location=Sequence derived from alignment at H-akashiwo_Contig834:404285..404967- (Heterosigma akashiwo CCMP452)back to top |