prot_H-akashiwo_Contig974.9.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Match: A0A140ECJ4_9STRA (NADH dehydrogenase subunit 11 n=1 Tax=Monodopsis sp. MarTras21 TaxID=1745953 RepID=A0A140ECJ4_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 1.360e-9 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 4 RKSVSKAEKVFQGRAISCSFSSVFHLRKAGMKEADFQLVTRIFKVGILIPL 54 R ++S AE V RA+SCSF+SVFHL+KAGMK A+F VTR+FK ++ P+ Sbjct: 240 RPAMSSAEGVMSRRALSCSFTSVFHLQKAGMKAAEFARVTRLFKHAVIAPM 290
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Match: A0A140ECJ3_9STRA (NADH dehydrogenase subunit 11 n=1 Tax=Vischeria sp. CAUP Q 202 TaxID=1805947 RepID=A0A140ECJ3_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 1.780e-9 Identity = 30/56 (53.57%), Postives = 39/56 (69.64%), Query Frame = 0 Query: 8 SKAEKVFQGRAISCSFSSVFHLRKAGMKEADFQLVTRIFKVGILIPLGAFGLLAGG 63 S AE V RA+SCSF+SVFHL+KAGM+ D Q VT +FK +++P+ F AGG Sbjct: 234 SSAEAVMSRRALSCSFTSVFHLQKAGMRPKDLQKVTSVFKKAVVLPMAVF---AGG 286
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Match: W7UBW7_9STRA (Nadh dehydrogenase subunit 11 n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7UBW7_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 6.560e-8 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 0 Query: 3 PRKSVSKAEKVFQGRAISCSFSSVFHLRKAGMKEADFQLVTRIFKVGILIPLGA 56 P S A V RA+SCSF+SVFHL+KAGM DFQ VT +FK +++P+ A Sbjct: 254 PPASQGAAMGVMSRRALSCSFTSVFHLQKAGMAPQDFQKVTSLFKRSVILPMAA 307 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig974.9.1 ID=prot_H-akashiwo_Contig974.9.1|Name=mRNA_H-akashiwo_Contig974.9.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=91bpback to top |