mRNA_H-akashiwo_Contig974.9.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Match: A0A140ECJ4_9STRA (NADH dehydrogenase subunit 11 n=1 Tax=Monodopsis sp. MarTras21 TaxID=1745953 RepID=A0A140ECJ4_9STRA) HSP 1 Score: 64.3 bits (155), Expect = 1.490e-8 Identity = 29/51 (56.86%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 193 RKSVSKAEKVFQGRAISCSFSSVFHLRKAGMKEADFQLVTRIFKVGILIPL 345 R ++S AE V RA+SCSF+SVFHL+KAGMK A+F VTR+FK ++ P+ Sbjct: 240 RPAMSSAEGVMSRRALSCSFTSVFHLQKAGMKAAEFARVTRLFKHAVIAPM 290
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Match: A0A140ECJ3_9STRA (NADH dehydrogenase subunit 11 n=1 Tax=Vischeria sp. CAUP Q 202 TaxID=1805947 RepID=A0A140ECJ3_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 2.580e-8 Identity = 33/61 (54.10%), Postives = 42/61 (68.85%), Query Frame = 1 Query: 193 RKSV-SKAEKVFQGRAISCSFSSVFHLRKAGMKEADFQLVTRIFKVGILIPLGAFGLLAGG 372 R SV S AE V RA+SCSF+SVFHL+KAGM+ D Q VT +FK +++P+ F AGG Sbjct: 229 RSSVPSSAEAVMSRRALSCSFTSVFHLQKAGMRPKDLQKVTSVFKKAVVLPMAVF---AGG 286
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Match: W7UBW7_9STRA (Nadh dehydrogenase subunit 11 n=2 Tax=Monodopsidaceae TaxID=425072 RepID=W7UBW7_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 6.290e-7 Identity = 28/54 (51.85%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 190 PRKSVSKAEKVFQGRAISCSFSSVFHLRKAGMKEADFQLVTRIFKVGILIPLGA 351 P S A V RA+SCSF+SVFHL+KAGM DFQ VT +FK +++P+ A Sbjct: 254 PPASQGAAMGVMSRRALSCSFTSVFHLQKAGMAPQDFQKVTSLFKRSVILPMAA 307 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig974.9.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig974.9.1 >prot_H-akashiwo_Contig974.9.1 ID=prot_H-akashiwo_Contig974.9.1|Name=mRNA_H-akashiwo_Contig974.9.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=91bp MEPRKSVSKAEKVFQGRAISCSFSSVFHLRKAGMKEADFQLVTRIFKVGIback to top mRNA from alignment at H-akashiwo_Contig974:340066..340868- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig974.9.1 ID=mRNA_H-akashiwo_Contig974.9.1|Name=mRNA_H-akashiwo_Contig974.9.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=803bp|location=Sequence derived from alignment at H-akashiwo_Contig974:340066..340868- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig974:340066..340868- >mRNA_H-akashiwo_Contig974.9.1 ID=mRNA_H-akashiwo_Contig974.9.1|Name=mRNA_H-akashiwo_Contig974.9.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=273bp|location=Sequence derived from alignment at H-akashiwo_Contig974:340066..340868- (Heterosigma akashiwo CCMP452)back to top |