prot_H-akashiwo_Contig937.2.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig937.2.1 vs. uniprot
Match: A0A7S3UUK6_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UUK6_HETAK) HSP 1 Score: 98.6 bits (244), Expect = 5.640e-25 Identity = 53/53 (100.00%), Postives = 53/53 (100.00%), Query Frame = 0 Query: 1 MGKGDRTQVQFISEQAFSKEETQEDAEGMDRSSSRPSASWEMKEAIKYRKVKK 53 MGKGDRTQVQFISEQAFSKEETQEDAEGMDRSSSRPSASWEMKEAIKYRKVKK Sbjct: 62 MGKGDRTQVQFISEQAFSKEETQEDAEGMDRSSSRPSASWEMKEAIKYRKVKK 114
BLAST of mRNA_H-akashiwo_Contig937.2.1 vs. uniprot
Match: A0A6V1NLH2_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1NLH2_HETAK) HSP 1 Score: 57.0 bits (136), Expect = 3.290e-9 Identity = 31/35 (88.57%), Postives = 32/35 (91.43%), Query Frame = 0 Query: 19 KEETQEDAEGMDRSSSRPSASWEMKEAIKYRKVKK 53 K E + DAEGMDRSSSRPSASWEMKEAIKYRKVKK Sbjct: 26 KVEEKSDAEGMDRSSSRPSASWEMKEAIKYRKVKK 60 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig937.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig937.2.1 ID=prot_H-akashiwo_Contig937.2.1|Name=mRNA_H-akashiwo_Contig937.2.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=53bpback to top |