prot_H-akashiwo_Contig931.4.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig931.4.1 vs. uniprot
Match: D7FV62_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FV62_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 3.780e-8 Identity = 34/77 (44.16%), Postives = 47/77 (61.04%), Query Frame = 0 Query: 1 MDFSRPHTALISLQRRDGVSEELKELANRLLPNFEA---GASTESQLAARESILQMINMECWEGVAVGLLLAKSIVE 74 MDFS H AL SL+RR S+ LK LA +L F G ++Q + +L+++ E WEGV+VG LLAKS+V+ Sbjct: 1 MDFSSTHAALRSLKRRPTTSDALKNLAEKLEGPFAGDGKGLGDDTQ-DVEQDVLELLGTEEWEGVSVGFLLAKSLVD 76 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig931.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig931.4.1 ID=prot_H-akashiwo_Contig931.4.1|Name=mRNA_H-akashiwo_Contig931.4.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=81bpback to top |