prot_H-akashiwo_Contig92.3.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig92.3.1 vs. uniprot
Match: A0A7S3Y8X5_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y8X5_HETAK) HSP 1 Score: 54.7 bits (130), Expect = 1.080e-5 Identity = 24/31 (77.42%), Postives = 27/31 (87.10%), Query Frame = 0 Query: 3 ATCSKVPSFAFEGERRGRFCAQHKLPGMENV 33 A CSKVPSF FEGE+RGRFCAQHK+ GM +V Sbjct: 11 AGCSKVPSFNFEGEQRGRFCAQHKVQGMVDV 41
BLAST of mRNA_H-akashiwo_Contig92.3.1 vs. uniprot
Match: A0A7S3Y1J6_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y1J6_HETAK) HSP 1 Score: 55.5 bits (132), Expect = 1.630e-5 Identity = 24/33 (72.73%), Postives = 27/33 (81.82%), Query Frame = 0 Query: 2 HATCSKVPSFAFEGERRGRFCAQHKLPGMENVR 34 HA C+KV +AFEGE+R RFC QHKLPGM NVR Sbjct: 17 HAGCTKVHYYAFEGEKRPRFCGQHKLPGMVNVR 49
BLAST of mRNA_H-akashiwo_Contig92.3.1 vs. uniprot
Match: A0A7S4DD22_HETAK (Hypothetical protein (Fragment) n=2 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DD22_HETAK) HSP 1 Score: 55.5 bits (132), Expect = 4.890e-5 Identity = 25/33 (75.76%), Postives = 26/33 (78.79%), Query Frame = 0 Query: 2 HATCSKVPSFAFEGERRGRFCAQHKLPGMENVR 34 HA CSK P F FEGERRGRFCAQHK GM NV+ Sbjct: 148 HAGCSKEPVFNFEGERRGRFCAQHKEQGMVNVK 180 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig92.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig92.3.1 ID=prot_H-akashiwo_Contig92.3.1|Name=mRNA_H-akashiwo_Contig92.3.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=643bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|