prot_H-akashiwo_Contig831.4.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig831.4.1 vs. uniprot
Match: A0A7S4D5N3_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D5N3_HETAK) HSP 1 Score: 119 bits (297), Expect = 4.190e-32 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0 Query: 1 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFHH 54 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFHH Sbjct: 5 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFHH 58
BLAST of mRNA_H-akashiwo_Contig831.4.1 vs. uniprot
Match: A0A7M7N7R2_STRPU (Uncharacterized protein n=2 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=A0A7M7N7R2_STRPU) HSP 1 Score: 49.7 bits (117), Expect = 1.660e-5 Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 0 Query: 1 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFH 53 G VR L V W+++R E+ S+K + EGL L RG+SPYAGD+FH Sbjct: 19 GVTVRSVLFNSFVSSWLTDRVEISTPLTSWKSMVEGLTLLERGISPYAGDTFH 71 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig831.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig831.4.1 ID=prot_H-akashiwo_Contig831.4.1|Name=mRNA_H-akashiwo_Contig831.4.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=54bpback to top |