prot_H-akashiwo_Contig809.8.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig809.8.1 vs. uniprot
Match: A0A7S1D0J8_CYCTE (Hypothetical protein n=1 Tax=Cyclophora tenuis TaxID=216820 RepID=A0A7S1D0J8_CYCTE) HSP 1 Score: 50.8 bits (120), Expect = 3.010e-5 Identity = 27/72 (37.50%), Postives = 39/72 (54.17%), Query Frame = 0 Query: 5 TSYEFYKGSEQLNYLRHTRDFDFPFSEGLAANLQDFFCARDGAWARALGRP-WRPPSGAPRENLIEILKTFW 75 T++E KG ++YL+ TR+ DFPFS+GL NL+ F C RD A G W+P +I + +W Sbjct: 62 TTFECGKGPRHVDYLKGTRETDFPFSKGLDQNLRIFCCQRDAACIWLTGEAQWKPILWQTPGKIIRDSEDWW 133 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig809.8.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig809.8.1 ID=prot_H-akashiwo_Contig809.8.1|Name=mRNA_H-akashiwo_Contig809.8.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=137bpback to top |