prot_H-akashiwo_Contig1027.7.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A6H5KXY4_9PHAE (YjgF_endoribonc domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KXY4_9PHAE) HSP 1 Score: 60.8 bits (146), Expect = 3.140e-10 Identity = 25/39 (64.10%), Postives = 34/39 (87.18%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEEG 39 +F FGE+G+HSR+AVGTN+LP+ +PVEIEAIVE ++G Sbjct: 134 LFAEVFGERGVHSRSAVGTNALPMNVPVEIEAIVEFDDG 172
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A4D9CNR0_9STRA (YjgF_endoribonc domain-containing protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9CNR0_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 7.230e-10 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEE 38 F FG+KG+H+R+AVGTN+LPL IPVEIEAIVEVE+ Sbjct: 117 FFVQVFGDKGVHARSAVGTNALPLNIPVEIEAIVEVED 154
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A4D9CNR9_9STRA (YjgF_endoribonc domain-containing protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9CNR9_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 1.180e-9 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEE 38 F FG+KG+H+R+AVGTN+LPL IPVEIEAIVEVE+ Sbjct: 147 FFVQVFGDKGVHARSAVGTNALPLNIPVEIEAIVEVED 184
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: W7TB75_9STRA (Endoribonuclease l-psp n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TB75_9STRA) HSP 1 Score: 59.3 bits (142), Expect = 2.160e-9 Identity = 27/38 (71.05%), Postives = 33/38 (86.84%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEE 38 F FG+KG+H+R+AVGTN+LPL IPVEIEAIVEVE+ Sbjct: 198 FFVQVFGDKGVHARSAVGTNALPLNIPVEIEAIVEVED 235
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A2R5GI79_9STRA (Protein TCP17 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GI79_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 3.220e-9 Identity = 25/38 (65.79%), Postives = 32/38 (84.21%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEE 38 +F GE+G+H+R+AVGTNSLPL IPVE+EAIVE+ E Sbjct: 146 LFAEVLGERGLHARSAVGTNSLPLNIPVEVEAIVEISE 183
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A485KSR4_9STRA (Aste57867_10922 protein n=1 Tax=Aphanomyces stellatus TaxID=120398 RepID=A0A485KSR4_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 5.390e-9 Identity = 25/36 (69.44%), Postives = 32/36 (88.89%), Query Frame = 0 Query: 3 GTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEE 38 G FGE+G+H+R+AVGTN+LPL IPVE+E IVEVE+ Sbjct: 136 GEIFGERGVHARSAVGTNALPLGIPVEVECIVEVED 171
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A0M0J7D8_9EUKA (Endoribonuclease l-psp n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0J7D8_9EUKA) HSP 1 Score: 56.6 bits (135), Expect = 6.180e-9 Identity = 24/38 (63.16%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEE 38 + G FGE+G+H+R+AVGTNSLP +PVEIE I EVE+ Sbjct: 103 LLGAVFGERGVHARSAVGTNSLPRNVPVEIELIAEVED 140
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A812PJA3_9DINO (TCP17 protein n=1 Tax=Symbiodinium sp. KB8 TaxID=230985 RepID=A0A812PJA3_9DINO) HSP 1 Score: 57.4 bits (137), Expect = 7.050e-9 Identity = 24/39 (61.54%), Postives = 33/39 (84.62%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEEG 39 +FG FG +G+H+R+A+GTN+LPL +PVEIEAIVE+ G Sbjct: 144 LFGKVFGARGVHARSALGTNALPLNVPVEIEAIVELYPG 182
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A067CYL7_SAPPC (YjgF_endoribonc domain-containing protein n=4 Tax=Saprolegniaceae TaxID=4764 RepID=A0A067CYL7_SAPPC) HSP 1 Score: 56.6 bits (135), Expect = 9.840e-9 Identity = 25/35 (71.43%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 3 GTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVE 37 G FGE+G+H+R+AVGTN+LPL IPVE+E IVEVE Sbjct: 132 GKIFGERGVHARSAVGTNALPLGIPVEVECIVEVE 166
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Match: A0A2H5YEN0_9BACT (YjgF_endoribonc domain-containing protein n=1 Tax=bacterium HR23 TaxID=2035418 RepID=A0A2H5YEN0_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 2.180e-8 Identity = 27/38 (71.05%), Postives = 30/38 (78.95%), Query Frame = 0 Query: 1 MFGTCFGEKGIHSRAAVGTNSLPLRIPVEIEAIVEVEE 38 +F FGEKG H+R+AVG SLP IPVEIEAIVEVEE Sbjct: 116 LFVAVFGEKGRHARSAVGMGSLPFNIPVEIEAIVEVEE 153 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1027.7.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig1027.7.1 ID=prot_H-akashiwo_Contig1027.7.1|Name=mRNA_H-akashiwo_Contig1027.7.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=41bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|