mRNA_H-akashiwo_Contig99.29.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: A0A7S3UXL7_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UXL7_HETAK) HSP 1 Score: 67.0 bits (162), Expect = 3.010e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3 Query: 138 MAAAHPNNPGWYEPFLIDVAAKGAGGKAST 227 MAAAHPNNPGWYEPFLIDVAAKGAGGKAST Sbjct: 1 MAAAHPNNPGWYEPFLIDVAAKGAGGKAST 30
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: A0A6A3N8K3_9STRA (3'-5' exonuclease domain-containing protein n=3 Tax=Phytophthora TaxID=4783 RepID=A0A6A3N8K3_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 1.070e-10 Identity = 30/50 (60.00%), Postives = 38/50 (76.00%), Query Frame = 3 Query: 6 AKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAHP 155 A+ +LG LDK R+SDW RRPL+PAQ++YAALDAH LV I+ +M HP Sbjct: 519 AETYLGLPLDKRARMSDWERRPLTPAQLQYAALDAHVLVQIYYKMQEQHP 568
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: G4YFM3_PHYSP (3'-5' exonuclease domain-containing protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4YFM3_PHYSP) HSP 1 Score: 65.5 bits (158), Expect = 1.070e-10 Identity = 30/50 (60.00%), Postives = 38/50 (76.00%), Query Frame = 3 Query: 6 AKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAHP 155 A+ +LG LDK R+SDW RRPL+PAQ++YAALDAH LV I+ +M HP Sbjct: 522 AETYLGLPLDKRARMSDWERRPLTPAQLQYAALDAHVLVQIYYKMQEQHP 571
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: K3W9R8_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3W9R8_GLOUD) HSP 1 Score: 65.5 bits (158), Expect = 1.070e-10 Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = 3 Query: 3 TAKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAHPN 158 A+ +LGK LDK R+S+W RRPL+ AQ+ YAALDAH LV I QQM HP+ Sbjct: 572 VAELYLGKPLDKRARMSNWERRPLTRAQLHYAALDAHVLVRILQQMQQRHPH 623
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: H3GUX1_PHYRM (Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GUX1_PHYRM) HSP 1 Score: 63.9 bits (154), Expect = 3.730e-10 Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 3 Query: 6 AKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAHPNNPGWYEPFL 185 A+ +LG LDK R+SDW RRPLS AQ++YAALDAH LV I+ +M HP +EP L Sbjct: 520 AEAYLGLPLDKRVRMSDWERRPLSQAQLQYAALDAHVLVQIYYKMQEQHPVET--FEPVL 577
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: A0A3F2RPC9_9STRA (Uncharacterized protein n=4 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3F2RPC9_9STRA) HSP 1 Score: 62.8 bits (151), Expect = 9.530e-10 Identity = 29/51 (56.86%), Postives = 36/51 (70.59%), Query Frame = 3 Query: 3 TAKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAHP 155 A+ +LG LDK R+SDW RRPL+ AQ+ YAALDAH LV I+ +M HP Sbjct: 526 VAEDYLGLPLDKRPRMSDWERRPLTQAQLHYAALDAHVLVQIYYKMQEQHP 576
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: D8LNF2_ECTSI (RanBD1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LNF2_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 9.570e-10 Identity = 30/46 (65.22%), Postives = 34/46 (73.91%), Query Frame = 3 Query: 3 TAKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQM 140 T + WLGK LDK E S W RPL+ QVRYAALDAHCLV IF++M Sbjct: 558 TCEAWLGKPLDKTECASKWDVRPLTADQVRYAALDAHCLVGIFEEM 603
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: M4BL55_HYAAE (Uncharacterized protein n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4BL55_HYAAE) HSP 1 Score: 62.4 bits (150), Expect = 1.300e-9 Identity = 29/51 (56.86%), Postives = 36/51 (70.59%), Query Frame = 3 Query: 3 TAKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAHP 155 AK +LG LDK R+S+W RRPL+ AQ+ YAALDAH LV I+ +M HP Sbjct: 495 VAKSYLGFSLDKRVRMSNWERRPLTQAQLHYAALDAHVLVQIYYKMGEKHP 545
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: W2FXI6_PHYPR (Uncharacterized protein n=7 Tax=Phytophthora TaxID=4783 RepID=W2FXI6_PHYPR) HSP 1 Score: 62.4 bits (150), Expect = 1.300e-9 Identity = 29/50 (58.00%), Postives = 36/50 (72.00%), Query Frame = 3 Query: 6 AKHWLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAHP 155 A+ +LG LDK R+SDW RRPL+ AQ+ YAALDAH LV I+ +M HP Sbjct: 515 AESYLGLPLDKRARMSDWERRPLTQAQLHYAALDAHVLVQIYYKMQEQHP 564
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Match: A0A5D6XP07_9STRA (3'-5' exonuclease domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XP07_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 2.430e-9 Identity = 30/46 (65.22%), Postives = 33/46 (71.74%), Query Frame = 3 Query: 15 WLGKHLDKGERLSDWARRPLSPAQVRYAALDAHCLVLIFQQMAAAH 152 +LGK LDK RLSDW RRPL+ AQ+ YAALDAH LV I QM H Sbjct: 507 YLGKPLDKRARLSDWERRPLTRAQLHYAALDAHVLVRILAQMQQQH 552 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig99.29.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig99.29.1 >prot_H-akashiwo_Contig99.29.1 ID=prot_H-akashiwo_Contig99.29.1|Name=mRNA_H-akashiwo_Contig99.29.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=76bp PRPSTGWGSTWTRASGCRTGRGARCPPPRSATQRLTRTVLSSFSSRWQQRback to top mRNA from alignment at H-akashiwo_Contig99:1636188..1643519+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig99.29.1 ID=mRNA_H-akashiwo_Contig99.29.1|Name=mRNA_H-akashiwo_Contig99.29.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=7332bp|location=Sequence derived from alignment at H-akashiwo_Contig99:1636188..1643519+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig99:1636188..1643519+ >mRNA_H-akashiwo_Contig99.29.1 ID=mRNA_H-akashiwo_Contig99.29.1|Name=mRNA_H-akashiwo_Contig99.29.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=228bp|location=Sequence derived from alignment at H-akashiwo_Contig99:1636188..1643519+ (Heterosigma akashiwo CCMP452)back to top |