mRNA_H-akashiwo_Contig98.28.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: A0A6H5JI70_9PHAE (5'-nucleotidase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JI70_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 3.480e-11 Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 76 TPRVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 +PRV ++ +D K +R + G D LQ+ISDFD+TLTKF VNG++G SCH +++ Sbjct: 16 SPRVLFRDAEDFERKWQRIVAGGVDRLQIISDFDFTLTKFWVNGKRGDSCHAVID 70
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: A0A0G4EJZ4_VITBC (5'-nucleotidase n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EJZ4_VITBC) HSP 1 Score: 63.5 bits (153), Expect = 5.550e-10 Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1 Query: 52 NDTSSLLTTPRVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 N L TP + +KN + + K++RF DG D LQ+I+DFD TLT+ ++G++ +SCH ++E Sbjct: 11 NGALPLRLTPNIRVKNAEQLLEKLKRFRRDGTDALQVITDFDATLTQVFIDGQRASSCHSVVE 73
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: A0A7S3UTG8_HETAK (5'-nucleotidase (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3UTG8_HETAK) HSP 1 Score: 61.2 bits (147), Expect = 3.590e-9 Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 1 Query: 85 VFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGIL 237 V IK+ D K+ RF DG +Q+ISDFDYTLTKF+ +G+ G S HG+L Sbjct: 65 VTIKDRDAVFGKLERFFADGPGKIQIISDFDYTLTKFHYDGKMGKSTHGVL 115
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: UPI000F556A1A (cytosolic 5'-nucleotidase 3-like isoform X1 n=2 Tax=Pocillopora damicornis TaxID=46731 RepID=UPI000F556A1A) HSP 1 Score: 60.5 bits (145), Expect = 6.640e-9 Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 79 PRVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 P V+I+N K+++ E G + LQ+ISDFD TLTKF +NG KG + +G++E Sbjct: 50 PNVYIRNYVGVREKLKKLYEGGPEKLQIISDFDKTLTKFVINGEKGCTVYGVIE 103
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: A0A3M6TID4_POCDA (5'-nucleotidase n=1 Tax=Pocillopora damicornis TaxID=46731 RepID=A0A3M6TID4_POCDA) HSP 1 Score: 60.5 bits (145), Expect = 7.750e-9 Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 79 PRVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 P V+I+N K+++ E G + LQ+ISDFD TLTKF +NG KG + +G++E Sbjct: 52 PNVYIRNYVGVREKLKKLYEGGPEKLQIISDFDKTLTKFVINGEKGCTVYGVIE 105
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: A0A388LLW2_CHABU (5'-nucleotidase n=1 Tax=Chara braunii TaxID=69332 RepID=A0A388LLW2_CHABU) HSP 1 Score: 60.5 bits (145), Expect = 7.830e-9 Identity = 28/54 (51.85%), Postives = 35/54 (64.81%), Query Frame = 1 Query: 79 PRVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 PRV I NV++ K + G LQ+I+DFD TLTKF VNGRKG +CH +L Sbjct: 1341 PRVLIGNVEELERKKKAIRLGGRSKLQVIADFDMTLTKFRVNGRKGQTCHALLS 1394
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: A0A0D2U9Z3_CAPO3 (5'-nucleotidase n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=A0A0D2U9Z3_CAPO3) HSP 1 Score: 59.7 bits (143), Expect = 1.360e-8 Identity = 26/53 (49.06%), Postives = 37/53 (69.81%), Query Frame = 1 Query: 82 RVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 R+ I N + AK+ ++ G +LQ+ISDFD TLT+F NG++GAS HGI+E Sbjct: 107 RIIIGNSEAFQAKLEAIVQGGPQSLQVISDFDMTLTRFLYNGKRGASSHGIIE 159
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: UPI0001FE3700 (5'-nucleotidase n=1 Tax=Capsaspora owczarzaki (strain ATCC 30864) TaxID=595528 RepID=UPI0001FE3700) HSP 1 Score: 59.7 bits (143), Expect = 1.380e-8 Identity = 26/53 (49.06%), Postives = 37/53 (69.81%), Query Frame = 1 Query: 82 RVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 R+ I N + AK+ ++ G +LQ+ISDFD TLT+F NG++GAS HGI+E Sbjct: 144 RIIIGNSEAFQAKLEAIVQGGPQSLQVISDFDMTLTRFLYNGKRGASSHGIIE 196
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: A0A3P7LFT8_DIBLA (5'-nucleotidase n=1 Tax=Dibothriocephalus latus TaxID=60516 RepID=A0A3P7LFT8_DIBLA) HSP 1 Score: 58.9 bits (141), Expect = 2.250e-8 Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 1 Query: 82 RVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 ++ IKN D K+ R I G +NLQ+ISDFD+TL+KF NG + SCHGI E Sbjct: 5 QLHIKNPDVVKRKLTRIIALGKNNLQVISDFDWTLSKFYHNGERYPSCHGIFE 57
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Match: UPI0009E22FA7 (cytosolic 5'-nucleotidase 3-like isoform X1 n=2 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E22FA7) HSP 1 Score: 58.9 bits (141), Expect = 2.370e-8 Identity = 24/54 (44.44%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 79 PRVFIKNVDDTMAKIRRFIEDGADNLQLISDFDYTLTKFNVNGRKGASCHGILE 240 P V++++ K++ E G++ LQ+ISDFD TLTKFN+NG KG + +G++E Sbjct: 50 PNVYMRDSVHVREKLKVLYEGGSEKLQVISDFDKTLTKFNINGEKGCTVYGVIE 103 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig98.28.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig98.28.1 >prot_H-akashiwo_Contig98.28.1 ID=prot_H-akashiwo_Contig98.28.1|Name=mRNA_H-akashiwo_Contig98.28.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=80bp MGWIHLLVPGIVFLAVMNDTSSLLTTPRVFIKNVDDTMAKIRRFIEDGADback to top mRNA from alignment at H-akashiwo_Contig98:1451986..1453613- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig98.28.1 ID=mRNA_H-akashiwo_Contig98.28.1|Name=mRNA_H-akashiwo_Contig98.28.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=1628bp|location=Sequence derived from alignment at H-akashiwo_Contig98:1451986..1453613- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig98:1451986..1453613- >mRNA_H-akashiwo_Contig98.28.1 ID=mRNA_H-akashiwo_Contig98.28.1|Name=mRNA_H-akashiwo_Contig98.28.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=240bp|location=Sequence derived from alignment at H-akashiwo_Contig98:1451986..1453613- (Heterosigma akashiwo CCMP452)back to top |