mRNA_H-akashiwo_Contig967.5.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig967.5.1 vs. uniprot
Match: A0A7S4DG95_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DG95_HETAK) HSP 1 Score: 62.4 bits (150), Expect = 2.530e-10 Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = 1 Query: 97 ARDRELAGEEYFGSEELLNLQKQHAVVLQRFWR 195 ARDREL +EYFGSEELLNLQKQHAVVLQRFWR Sbjct: 143 ARDRELRAQEYFGSEELLNLQKQHAVVLQRFWR 175 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig967.5.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig967.5.1 >prot_H-akashiwo_Contig967.5.1 ID=prot_H-akashiwo_Contig967.5.1|Name=mRNA_H-akashiwo_Contig967.5.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=73bp AGTRRRRSSSRAASRPSARRARRWRARPAPGRARDRELAGEEYFGSEELLback to top mRNA from alignment at H-akashiwo_Contig967:378086..379599- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig967.5.1 ID=mRNA_H-akashiwo_Contig967.5.1|Name=mRNA_H-akashiwo_Contig967.5.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=1514bp|location=Sequence derived from alignment at H-akashiwo_Contig967:378086..379599- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig967:378086..379599- >mRNA_H-akashiwo_Contig967.5.1 ID=mRNA_H-akashiwo_Contig967.5.1|Name=mRNA_H-akashiwo_Contig967.5.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=219bp|location=Sequence derived from alignment at H-akashiwo_Contig967:378086..379599- (Heterosigma akashiwo CCMP452)back to top |