mRNA_H-akashiwo_Contig9.63.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A7S2B5T1_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2B5T1_9STRA) HSP 1 Score: 67.4 bits (163), Expect = 6.490e-11 Identity = 39/89 (43.82%), Postives = 55/89 (61.80%), Query Frame = 1 Query: 22 GNEDAGENSTVRVEGIIMTLMEAFQSE--EVEE--PGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQ 276 G+E+ G + E II +++ F + ++E+ L PDE GPYQNV +QE+ + TL+A R L ELQ G G+LTM+D MEALQ Sbjct: 1964 GDEEGGASPVAAAEAIIADVLDRFGEKNFDIEDLARSLGPDEQGPYQNVFMQEMDVINTLVAEMVRSLKELQLGFAGELTMSDSMEALQ 2052
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: D7FYT3_ECTSI (Dynein heavy chain n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FYT3_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 1.790e-8 Identity = 35/74 (47.30%), Postives = 48/74 (64.86%), Query Frame = 1 Query: 58 VEGIIMTLMEAFQSE--EVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEAL 273 V G+ T+++ F + +VE+ G S +E GPYQNV +QE+ + TLLA R L ELQ G G+LTM+D ME L Sbjct: 4141 VGGMSETILDKFGEKKFDVEDIGRSLEEAGPYQNVFIQEMDVMNTLLAEIVRSLKELQLGFAGELTMSDAMEGL 4214
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: B8C065_THAPS (Uncharacterized protein n=1 Tax=Thalassiosira pseudonana TaxID=35128 RepID=B8C065_THAPS) HSP 1 Score: 60.1 bits (144), Expect = 2.440e-8 Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 1 Query: 79 LMEAFQSE--EVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQV 279 L+E F + +VEE S DE+GPYQNV +QE+ + LLA +R + ELQ G +G+LTM++PME L + Sbjct: 4149 LLEKFGEKTFDVEELVRSLDEIGPYQNVFIQEMDVMNVLLAEIKRSIKELQLGFDGELTMSEPMEDLMM 4217
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A7S1UFN1_9STRA (Hypothetical protein n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1UFN1_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 3.250e-8 Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 1 Query: 25 NEDAGENSTVRVEGIIMTLMEAFQ--SEEVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQ 276 N D ++S EG + ++E F+ + ++E S +E+GP+QNV LQE R+ L+ R L EL G G LTM+ MEALQ Sbjct: 1119 NSDGNQSSQQVAEGTLQDILETFRECAFDIEGTAASCEEMGPFQNVFLQECERMNVLIVEMIRSLTELDLGFRGDLTMSPQMEALQ 1204
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A7S2CVE7_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2CVE7_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 1.110e-7 Identity = 34/93 (36.56%), Postives = 55/93 (59.14%), Query Frame = 1 Query: 7 DLFQRGNEDAGENSTVRVEGIIMTLMEAFQSEEVEEPGL--SPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQV 279 DL + + +N R E ++ ++E ++ + PGL S D++GP++NV +QE RL L+ A LVEL G +G+LTM++ ME LQ+ Sbjct: 610 DLVSKQGPHSSQN---RSEEVLKDILENYKDNRFDVPGLLASIDDMGPFENVFIQECERLNVLIDAMVSSLVELDLGFKGELTMSERMEELQL 699
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A482RYG8_9ARCH (Uncharacterized protein (Fragment) n=1 Tax=archaeon TaxID=1906665 RepID=A0A482RYG8_9ARCH) HSP 1 Score: 57.4 bits (137), Expect = 2.160e-7 Identity = 30/72 (41.67%), Postives = 49/72 (68.06%), Query Frame = 1 Query: 67 IIMTLMEAFQSE--EVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQ 276 +++ +++ FQ + +V++ S +E+GPYQNV +QE+ + LLA R L ELQ G G+LTM+D M+AL+ Sbjct: 4236 VLLDVLDRFQEKKFDVDDIARSLEELGPYQNVFMQEMDVMNNLLAEMMRSLKELQLGFAGELTMSDQMDALK 4307
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A835YNN0_9STRA (Dynein heavy chain n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YNN0_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 7.510e-7 Identity = 31/68 (45.59%), Postives = 44/68 (64.71%), Query Frame = 1 Query: 76 TLMEAFQSE--EVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEAL 273 +++E F + +VE+ +E GPYQNV +QE+ + TLLA R L ELQ+G G+LTM+D ME L Sbjct: 4203 SVLERFAEKRFDVEDIARGLEEAGPYQNVFMQEMDVMNTLLAEVVRSLKELQQGFAGELTMSDAMERL 4270
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A5D6Y7I6_9STRA (Uncharacterized protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6Y7I6_9STRA) HSP 1 Score: 55.5 bits (132), Expect = 1.020e-6 Identity = 30/58 (51.72%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 103 EVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQ 276 E ++ S +E+GPYQNV LQE + LLA R L ELQ G G+LTM+D MEA+Q Sbjct: 3790 ECDDVARSLEEMGPYQNVFLQECETMNGLLAEIARSLTELQLGFAGELTMSDAMEAVQ 3847
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A6G0XX07_9STRA (Dynein_C domain-containing protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0XX07_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 1.850e-6 Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 103 EVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQ 276 EV++ S +E+GPYQNV LQE + LL R L ELQ G G+LTM+D ME++Q Sbjct: 12 EVDDIARSLEEIGPYQNVFLQECDAINVLLQEISRSLNELQLGFLGELTMSDAMESVQ 69
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Match: A0A067CKL6_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067CKL6_SAPPC) HSP 1 Score: 54.3 bits (129), Expect = 2.610e-6 Identity = 29/58 (50.00%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 103 EVEEPGLSPDEVGPYQNVLLQELGRLQTLLAAAERELVELQKGLEGKLTMTDPMEALQ 276 EV++ S +E+GPYQNV +QE + LL R L ELQ G G+LTM+D MEA+Q Sbjct: 4249 EVDDIARSLEEIGPYQNVFIQECDAINVLLQEIARSLNELQLGFLGELTMSDAMEAVQ 4306 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig9.63.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig9.63.1 >prot_H-akashiwo_Contig9.63.1 ID=prot_H-akashiwo_Contig9.63.1|Name=mRNA_H-akashiwo_Contig9.63.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=101bp DTDLFQRGNEDAGENSTVRVEGIIMTLMEAFQSEEVEEPGLSPDEVGPYQback to top mRNA from alignment at H-akashiwo_Contig9:4461331..4462044- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig9.63.1 ID=mRNA_H-akashiwo_Contig9.63.1|Name=mRNA_H-akashiwo_Contig9.63.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=714bp|location=Sequence derived from alignment at H-akashiwo_Contig9:4461331..4462044- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig9:4461331..4462044- >mRNA_H-akashiwo_Contig9.63.1 ID=mRNA_H-akashiwo_Contig9.63.1|Name=mRNA_H-akashiwo_Contig9.63.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=303bp|location=Sequence derived from alignment at H-akashiwo_Contig9:4461331..4462044- (Heterosigma akashiwo CCMP452)back to top |