mRNA_H-akashiwo_Contig831.4.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig831.4.1 vs. uniprot
Match: A0A7S4D5N3_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D5N3_HETAK) HSP 1 Score: 119 bits (297), Expect = 4.190e-32 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 1 Query: 1 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFHH 162 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFHH Sbjct: 5 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFHH 58
BLAST of mRNA_H-akashiwo_Contig831.4.1 vs. uniprot
Match: A0A7M7N7R2_STRPU (Uncharacterized protein n=2 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=A0A7M7N7R2_STRPU) HSP 1 Score: 49.7 bits (117), Expect = 1.660e-5 Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 1 Query: 1 GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDSFH 159 G VR L V W+++R E+ S+K + EGL L RG+SPYAGD+FH Sbjct: 19 GVTVRSVLFNSFVSSWLTDRVEISTPLTSWKSMVEGLTLLERGISPYAGDTFH 71 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig831.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig831.4.1 >prot_H-akashiwo_Contig831.4.1 ID=prot_H-akashiwo_Contig831.4.1|Name=mRNA_H-akashiwo_Contig831.4.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=54bp GFVVRLFLVWIGVDEWVSNRPELIPASHSFKDIQEGLFLKSRGLSPYAGDback to top mRNA from alignment at H-akashiwo_Contig831:58667..59125- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig831.4.1 ID=mRNA_H-akashiwo_Contig831.4.1|Name=mRNA_H-akashiwo_Contig831.4.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=459bp|location=Sequence derived from alignment at H-akashiwo_Contig831:58667..59125- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig831:58667..59125- >mRNA_H-akashiwo_Contig831.4.1 ID=mRNA_H-akashiwo_Contig831.4.1|Name=mRNA_H-akashiwo_Contig831.4.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=162bp|location=Sequence derived from alignment at H-akashiwo_Contig831:58667..59125- (Heterosigma akashiwo CCMP452)back to top |