mRNA_H-akashiwo_Contig804.10.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A7S2VYL2_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A7S2VYL2_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 1.130e-9 Identity = 23/39 (58.97%), Postives = 31/39 (79.49%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 G+VR N H DA+LDLK +D P K ++SCSRDG++KLW+ Sbjct: 215 GLVRPENHHKDAVLDLKKIDSPIKGLLSCSRDGVIKLWR 253
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A7S1YUM8_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S1YUM8_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 1.690e-8 Identity = 23/39 (58.97%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 G +R N H DAILDLK VD P ++SCSRDG++KLW+ Sbjct: 1348 GAMRPENHHRDAILDLKKVDFPMNGLLSCSRDGVIKLWR 1386
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A7S1CYZ9_CYCTE (Non-specific serine/threonine protein kinase n=1 Tax=Cyclophora tenuis TaxID=216820 RepID=A0A7S1CYZ9_CYCTE) HSP 1 Score: 58.2 bits (139), Expect = 1.700e-8 Identity = 23/39 (58.97%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 GM+R NRH D+I DLK + PT+ +ISCSRDG +KLW+ Sbjct: 229 GMIRAENRHRDSIQDLKLIQGPTQALISCSRDGSIKLWR 267
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A7S2WQI5_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2WQI5_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.490e-7 Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 G+ H DAILDLKSVDLP KM++S SRDG+VK WK Sbjct: 466 GLQPPTTAHMDAILDLKSVDLPIKMMLSSSRDGVVKCWK 504
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A7S3JYX0_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3JYX0_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.520e-7 Identity = 20/39 (51.28%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 G + P H DAILDLK++D P ++++SCSRDG++K W+ Sbjct: 1669 GPLAPPTAHRDAILDLKAIDYPLRIMLSCSRDGVIKAWR 1707
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A8J2WZP6_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2WZP6_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 5.240e-7 Identity = 21/31 (67.74%), Postives = 27/31 (87.10%), Query Frame = 1 Query: 25 HNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 H DA+LDLKSVDLP K+++S SRDG+VK W+ Sbjct: 608 HRDAVLDLKSVDLPAKLMLSASRDGVVKCWR 638
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: D8LRQ5_ECTSI (Non-specific serine/threonine protein kinase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LRQ5_ECTSI) HSP 1 Score: 54.3 bits (129), Expect = 5.300e-7 Identity = 22/39 (56.41%), Postives = 31/39 (79.49%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 G+V + H+DA+LD+K +LPTKM++S SRDG VK+WK Sbjct: 1422 GLVAPRSSHDDAVLDVKVTELPTKMLLSGSRDGAVKIWK 1460
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A835YVX7_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YVX7_9STRA) HSP 1 Score: 53.9 bits (128), Expect = 7.070e-7 Identity = 20/39 (51.28%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 G+ P H DAILDLK D+P K+++S SRDG+V +W+ Sbjct: 378 GVTAAPTAHEDAILDLKCTDMPLKLLLSSSRDGVVNVWR 416
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: W7TIJ6_9STRA (Non-specific serine/threonine protein kinase n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TIJ6_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 1.830e-6 Identity = 20/39 (51.28%), Postives = 29/39 (74.36%), Query Frame = 1 Query: 1 GMVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 G V P H AI+DLK+VD+P ++++SCSRD VK+W+ Sbjct: 105 GPVPPPTCHTGAIMDLKTVDVPVRLLLSCSRDETVKVWR 143
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Match: A0A7S1BKV4_9STRA (Non-specific serine/threonine protein kinase n=1 Tax=Corethron hystrix TaxID=216773 RepID=A0A7S1BKV4_9STRA) HSP 1 Score: 52.4 bits (124), Expect = 2.540e-6 Identity = 20/31 (64.52%), Postives = 26/31 (83.87%), Query Frame = 1 Query: 25 HNDAILDLKSVDLPTKMIISCSRDGIVKLWK 117 H D ILDLKSVD P K ++SCSR+G++KLW+ Sbjct: 1685 HRDTILDLKSVDYPMKGLLSCSRNGVIKLWR 1715 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig804.10.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 13
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig804.10.1 >prot_H-akashiwo_Contig804.10.1 ID=prot_H-akashiwo_Contig804.10.1|Name=mRNA_H-akashiwo_Contig804.10.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=40bp MVRVPNRHNDAILDLKSVDLPTKMIISCSRDGIVKLWKK*back to top mRNA from alignment at H-akashiwo_Contig804:500752..500936+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig804.10.1 ID=mRNA_H-akashiwo_Contig804.10.1|Name=mRNA_H-akashiwo_Contig804.10.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=185bp|location=Sequence derived from alignment at H-akashiwo_Contig804:500752..500936+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig804:500752..500936+ >mRNA_H-akashiwo_Contig804.10.1 ID=mRNA_H-akashiwo_Contig804.10.1|Name=mRNA_H-akashiwo_Contig804.10.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=120bp|location=Sequence derived from alignment at H-akashiwo_Contig804:500752..500936+ (Heterosigma akashiwo CCMP452)back to top |