mRNA_H-akashiwo_Contig1010.16.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1010.16.1 vs. uniprot
Match: A0A7S3Y5S6_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y5S6_HETAK) HSP 1 Score: 97.8 bits (242), Expect = 6.570e-23 Identity = 45/59 (76.27%), Postives = 50/59 (84.75%), Query Frame = 3 Query: 228 VQLTLFEQGTKEVLRSGFSDGCRILDWEQNLDKTAGGGHLSVVEWLHANRSEGCTREAM 404 +QLT+FE GTKE LRSGFSDGCRI WEQNLD+TA GGHL V+E+LHAN SEGCT AM Sbjct: 1 MQLTVFELGTKEALRSGFSDGCRISKWEQNLDQTARGGHLPVLEFLHANHSEGCTEAAM 59
BLAST of mRNA_H-akashiwo_Contig1010.16.1 vs. uniprot
Match: A0A7S4DAC4_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DAC4_HETAK) HSP 1 Score: 55.1 bits (131), Expect = 1.080e-6 Identity = 25/32 (78.12%), Postives = 26/32 (81.25%), Query Frame = 3 Query: 318 LDKTAGGGHLSVVEWLHANRSEGCTREAMVRA 413 +D AG GHL VVEWLHANRSEGCT EAM RA Sbjct: 3 MDFAAGNGHLCVVEWLHANRSEGCTTEAMDRA 34
BLAST of mRNA_H-akashiwo_Contig1010.16.1 vs. uniprot
Match: A0A7S4D904_HETAK (Hypothetical protein (Fragment) n=2 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D904_HETAK) HSP 1 Score: 52.4 bits (124), Expect = 3.210e-5 Identity = 21/42 (50.00%), Postives = 30/42 (71.43%), Query Frame = 3 Query: 279 FSDGCRILDWEQNLDKTAGGGHLSVVEWLHANRSEGCTREAM 404 F DG +W + +D+TAG G L+V+EWL+A +EGCT +AM Sbjct: 55 FLDGLEFSEWNKGIDQTAGLGQLTVLEWLNAKGTEGCTTDAM 96
BLAST of mRNA_H-akashiwo_Contig1010.16.1 vs. uniprot
Match: F4PJ10_CAVFA (Uncharacterized protein n=1 Tax=Cavenderia fasciculata (strain SH3) TaxID=1054147 RepID=F4PJ10_CAVFA) HSP 1 Score: 53.1 bits (126), Expect = 4.640e-5 Identity = 36/130 (27.69%), Postives = 59/130 (45.38%), Query Frame = 3 Query: 75 WPSIEGPRNLIVFLLGGGF--ENTPSFAGF---------------FQNTSIPPKIIPSTASAYNMFSLVQLTLFEQGTKEVLRSGFSDGCRILDWEQNLDKTAGGGHLSVVEWLHANRSEGCTREAMVRA 413 W + G N+I + G TP G ++ I P+ I + A+ + + ++ + Q KE+ +GF+ +D+ A GGHL +V+WLH NRSEGCT++A+ A Sbjct: 96 WAANYGNINVIKYFYSRGVLKHTTPGLLGKAMSCRNLEIIQFLVEIRSEQITPECI-NYAAGHGLLDTIKY--YHQKDKEIHHNGFTATA--------MDRAASGGHLEMVKWLHFNRSEGCTKQALDNA 214
BLAST of mRNA_H-akashiwo_Contig1010.16.1 vs. uniprot
Match: A0A7S3Y0J0_HETAK (Hypothetical protein (Fragment) n=2 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y0J0_HETAK) HSP 1 Score: 50.8 bits (120), Expect = 6.260e-5 Identity = 22/28 (78.57%), Postives = 23/28 (82.14%), Query Frame = 3 Query: 318 LDKTAGGGHLSVVEWLHANRSEGCTREA 401 +D AG GHL VVEWLHANRSEGCT EA Sbjct: 3 MDFAAGNGHLCVVEWLHANRSEGCTTEA 30 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1010.16.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig1010.16.1 >prot_H-akashiwo_Contig1010.16.1 ID=prot_H-akashiwo_Contig1010.16.1|Name=mRNA_H-akashiwo_Contig1010.16.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=169bp MPFHDTWKIDRNWPSIEGPRNLIVFLLGGGFENTPSFAGFFQNTSIPPKIback to top mRNA from alignment at H-akashiwo_Contig1010:387174..387718+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig1010.16.1 ID=mRNA_H-akashiwo_Contig1010.16.1|Name=mRNA_H-akashiwo_Contig1010.16.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=545bp|location=Sequence derived from alignment at H-akashiwo_Contig1010:387174..387718+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig1010:387174..387718+ >mRNA_H-akashiwo_Contig1010.16.1 ID=mRNA_H-akashiwo_Contig1010.16.1|Name=mRNA_H-akashiwo_Contig1010.16.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=507bp|location=Sequence derived from alignment at H-akashiwo_Contig1010:387174..387718+ (Heterosigma akashiwo CCMP452)back to top |