mRNA_H-akashiwo_Contig100.40.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: A0A7S3Y243_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3Y243_HETAK) HSP 1 Score: 115 bits (289), Expect = 6.380e-29 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 1 Query: 1 VAKEELPPMWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD 180 VAKEELPPMWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD Sbjct: 459 VAKEELPPMWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD 518
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: A0A6U1Q394_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A6U1Q394_9STRA) HSP 1 Score: 72.0 bits (175), Expect = 1.520e-14 Identity = 36/58 (62.07%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 7 KEELPPMWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFLD 180 ++ LPP WVP+ L G+G+LQ SLG+V + EA LGSASGARARKE+TR KKFLD Sbjct: 86 RDFLPPFWVPVGVAIALLGGVGLLQLSLGNVADDEAMLGSASGARARKESTRNKKFLD 143
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: D7G8H6_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G8H6_ECTSI) HSP 1 Score: 68.9 bits (167), Expect = 4.270e-13 Identity = 35/54 (64.81%), Postives = 41/54 (75.93%), Query Frame = 1 Query: 1 VAKEELPPMWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTR 162 V +LPPMWVPLA G VL +GIG+LQ SLGDVM EA LG+ SGARA K++ R Sbjct: 106 VVSSDLPPMWVPLAVGFVLTLGIGLLQGSLGDVMNDEAKLGALSGARAAKQSAR 159
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: A0A7S2SFC9_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SFC9_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 5.930e-9 Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 1 Query: 4 AKEELPPMWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRR 165 A +LPP +P+A A +FVG+G+LQ SLGDV EA LG +SGA ARKE R+ Sbjct: 83 APPDLPPPAIPVAFAAAIFVGVGLLQGSLGDVYGQEADLGMSSGANARKEAERK 136
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Match: K0T280_THAOC (Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0T280_THAOC) HSP 1 Score: 56.6 bits (135), Expect = 2.040e-8 Identity = 29/51 (56.86%), Postives = 37/51 (72.55%), Query Frame = 1 Query: 10 EELPPMWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTR 162 EELPP++VP+ + G+GVL ASLG+VM+ EA LG SGARA+KE R Sbjct: 102 EELPPVYVPIIFAIFVLGGVGVLTASLGNVMDEEASLGLQSGARAKKERDR 152 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig100.40.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig100.40.1 >prot_H-akashiwo_Contig100.40.1 ID=prot_H-akashiwo_Contig100.40.1|Name=mRNA_H-akashiwo_Contig100.40.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=53bp MWVPLATGAVLFVGIGVLQASLGDVMEAEAGLGSASGARARKENTRRKKFback to top mRNA from alignment at H-akashiwo_Contig100:1652843..1655193+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig100.40.1 ID=mRNA_H-akashiwo_Contig100.40.1|Name=mRNA_H-akashiwo_Contig100.40.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=2351bp|location=Sequence derived from alignment at H-akashiwo_Contig100:1652843..1655193+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig100:1652843..1655193+ >mRNA_H-akashiwo_Contig100.40.1 ID=mRNA_H-akashiwo_Contig100.40.1|Name=mRNA_H-akashiwo_Contig100.40.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=159bp|location=Sequence derived from alignment at H-akashiwo_Contig100:1652843..1655193+ (Heterosigma akashiwo CCMP452)back to top |