prot_H-canaliculatus_M_contigs9968.1.1 (polypeptide) Hapterophycus canaliculatus Oshoro7m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro7m male
Date Performed: 2022-09-29
ZOOM
x 1
POSITION
0
MSGKGKGGRGKKSTTRSAKAGLQFPVGRVGRFLKRGKYATRVGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKARIIPRHIQLAVRNDEELNKLLGEVTIASGGVLPNIHAVLLPKKVMKGKAP*102030405060708090100110120Score = 68.99Score = 90.36Score = 90.54Score = 77.52Score = 76.04Expect = 1.7E-78 / Score = 276.7Score = Expect = 7.76333E-68 / Score = 197.943Expect = 2.8E-19 / Score = 68.5Expect = 5.3E-15 / Score = 55.9Expect = 3.5E-63 / Score = 213.2Score = Expect = 2.5E-53 / Score = 179.4Score = Score = SequencePR00620SM00414PTHR23430cd00074PF16211PF00125G3DSA:1.10.20.10SSF47113PIRSR037942-1mobidb-litePTHR23430:SF288PS00046
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002119Histone H2APRINTSPR00620HISTONEH2Acoord: 12..34
score: 68.99
coord: 41..56
score: 90.36
coord: 98..116
score: 76.04
coord: 70..84
score: 77.52
coord: 56..69
score: 90.54
IPR002119Histone H2ASMARTSM00414h2a4coord: 3..121
e-value: 1.7E-78
score: 276.7
IPR002119Histone H2APANTHERPTHR23430HISTONE H2Acoord: 4..124
IPR002119Histone H2ACDDcd00074H2Acoord: 13..118
e-value: 7.76333E-68
score: 197.943
IPR032454Histone H2A, C-terminal domainPFAMPF16211Histone_H2A_Ccoord: 90..123
e-value: 2.8E-19
score: 68.5
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 11..87
e-value: 5.3E-15
score: 55.9
IPR009072Histone-foldGENE3D1.10.20.10Histone, subunit Acoord: 1..124
e-value: 3.5E-63
score: 213.2
IPR009072Histone-foldSUPERFAMILY47113Histone-foldcoord: 2..122
NoneNo IPR availablePIRSRPIRSR037942-1PIRSR037942-1coord: 5..119
e-value: 2.5E-53
score: 179.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availablePANTHERPTHR23430:SF288HISTONE H2Acoord: 4..124
IPR032458Histone H2A conserved sitePROSITEPS00046HISTONE_H2Acoord: 20..26