prot_H-canaliculatus_M_contigs996.1.1 (polypeptide) Hapterophycus canaliculatus Oshoro7m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_M_contigs996.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro7m male vs UniRef90)
Total hits: 9
ZOOM
x 1
POSITION
0
DPLVQYRDVLPVTYAFGTARCWSGYEGIQSDDDRFLTCHYNVFEPSWLQRNSIPLIVGGSFLAFFGSIIYFVVRRRLKRRFLQAKIERRRSRRSSEMSQLSQQPHAFAHRG*102030405060708090100110Expect = 1.11e-33 / Id = 63.00Expect = 6.63e-30 / Id = 93.10Expect = 9.35e-21 / Id = 47.71Expect = 4.01e-19 / Id = 46.73Expect = 4.13e-19 / Id = 48.08Expect = 1.00e-16 / Id = 43.75Expect = 3.86e-16 / Id = 47.37Expect = 1.40e-13 / Id = 32.69Expect = 1.03e-8 / Id = 32.97SequenceA0A835Z190_9STRAD8LSI8_ECTSIA0A7S3UTA0_HETAKA0A7S2FA90_9STRAA0A482T1I0_9ARCHA0A7S2AR06_9STRAA0A7S3JQX4_9STRAA0A8K1FDG1_PYTOLT0QKU1_SAPDV
Match NameE-valueIdentityDescription
A0A835Z190_9STRA1.110e-3363.00Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
D8LSI8_ECTSI6.630e-3093.10Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
A0A7S3UTA0_HETAK9.350e-2147.71Hypothetical protein n=1 Tax=Heterosigma akashiwo ... [more]
A0A7S2FA90_9STRA4.010e-1946.73Hypothetical protein n=1 Tax=Florenciella parvula ... [more]
A0A482T1I0_9ARCH4.130e-1948.08Uncharacterized protein n=1 Tax=archaeon TaxID=190... [more]
A0A7S2AR06_9STRA1.000e-1643.75Hypothetical protein n=1 Tax=Dictyocha speculum Ta... [more]
A0A7S3JQX4_9STRA3.860e-1647.37Hypothetical protein n=1 Tax=Aureoumbra lagunensis... [more]
A0A8K1FDG1_PYTOL1.400e-1332.69Uncharacterized protein n=1 Tax=Pythium oligandrum... [more]
T0QKU1_SAPDV1.030e-832.97Uncharacterized protein n=1 Tax=Saprolegnia diclin... [more]
back to top