prot_H-canaliculatus_M_contigs9812.1.1 (polypeptide) Hapterophycus canaliculatus Oshoro7m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro7m male
Date Performed: 2022-09-29
ZOOM
x 1
POSITION
0
MAERTLAQERTPGRFGEGEQTVTFSSLISLLAESFRLVRQPFGGKRCIVSRLPLPPCCESGYCVAHLERPASAALQGAPDGNLKRAALKIVFAQHDADGSGALEMEELPKILAEFGVEYDQKRLLDMFNIYDVDRSGALDFEEFSALLADMNADRAVAEKKMLAFHLPASLLKEFSPEAVEEMRVTFGLFDESGDGALDEEELGELLRKFGQEPTKEKIHKEMMEIDYDRSGTIEFQEFVMLMKKVS*20406080100120140160180200220240Expect = 5.9 / Score = 11.6Expect = 4.1E-5 / Score = 33.0Expect = 0.044 / Score = 22.9Expect = 1.7E-4 / Score = 30.9Expect = 2.0E-9 / Score = 37.7Expect = 4.1E-10 / Score = 40.0Score = 10.3012Score = 11.974924Score = 11.668075Score = 13.481276Expect = 3.78272E-10 / Score = 52.5501Expect = 2.2386E-11 / Score = 56.0169Expect = 3.4E-14 / Score = 55.1Expect = 3.8E-20 / Score = 73.8Score = Score = Score = Score = Score = Score = Score = Score = Score = SequenceSM00054PF13499PS50222PS50222PS50222PS50222cd00051cd00051G3DSA:1.10.238.10G3DSA:1.10.238.10PTHR23050:SF330PTHR23050PS00018PS00018PS00018PS00018SSF47473
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 123..151
e-value: 4.1E-5
score: 33.0
coord: 182..210
e-value: 0.044
score: 22.9
coord: 87..115
e-value: 5.9
score: 11.6
coord: 218..246
e-value: 1.7E-4
score: 30.9
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 183..243
e-value: 4.1E-10
score: 40.0
coord: 87..147
e-value: 2.0E-9
score: 37.7
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 83..118
score: 10.3012
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 178..213
score: 11.974924
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 214..247
score: 11.668075
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 119..154
score: 13.481276
IPR002048EF-hand domainCDDcd00051EFhcoord: 182..244
e-value: 3.78272E-10
score: 52.5501
IPR002048EF-hand domainCDDcd00051EFhcoord: 88..149
e-value: 2.2386E-11
score: 56.0169
NoneNo IPR availableGENE3D1.10.238.10coord: 64..157
e-value: 3.4E-14
score: 55.1
NoneNo IPR availableGENE3D1.10.238.10coord: 158..247
e-value: 3.8E-20
score: 73.8
NoneNo IPR availablePANTHERPTHR23050:SF330RE52086Pcoord: 85..155
coord: 177..245
NoneNo IPR availablePANTHERPTHR23050CALCIUM BINDING PROTEINcoord: 85..155
coord: 177..245
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 191..203
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 227..239
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 132..144
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 96..108
IPR011992EF-hand domain pairSUPERFAMILY47473EF-handcoord: 87..244