prot_H-canaliculatus_M_contigs9792.1.1 (polypeptide) Hapterophycus canaliculatus Oshoro7m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_M_contigs9792.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro7m male vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MDENRRVSGQLVQLATSVKVREAIYRSHMEASGGEINPAHQAAGRMKRITTRRRLVDLARAQTGEIEALKAELDRLRQRTFPSFAHAARNNLAVADTR*102030405060708090Expect = 2.21e-50 / Id = 92.78Expect = 6.06e-33 / Id = 65.59Expect = 7.03e-30 / Id = 69.57Expect = 1.51e-25 / Id = 68.24Expect = 4.36e-21 / Id = 62.22Expect = 1.14e-20 / Id = 57.58Expect = 1.81e-19 / Id = 52.58Expect = 5.22e-15 / Id = 51.69Expect = 5.65e-14 / Id = 47.56Expect = 8.64e-14 / Id = 50.56SequenceD7G902_ECTSIA0A7S2SEN3_9STRAA0A7S2CAS4_9STRAA0A7S1UCA8_9STRAA0A835YXJ9_9STRAA0A7S4DB68_HETAKA0A8J2WXW7_9STRAA0A3F2RUE6_9STRAA0A482S4Q2_9ARCHA0A0P1B4M1_PLAHL
Match NameE-valueIdentityDescription
D7G902_ECTSI2.210e-5092.78Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
A0A7S2SEN3_9STRA6.060e-3365.59Hypothetical protein n=1 Tax=Rhizochromulina marin... [more]
A0A7S2CAS4_9STRA7.030e-3069.57Hypothetical protein n=1 Tax=Florenciella parvula ... [more]
A0A7S1UCA8_9STRA1.510e-2568.24Hypothetical protein n=1 Tax=Phaeomonas parva TaxI... [more]
A0A835YXJ9_9STRA4.360e-2162.22Uncharacterized protein n=1 Tax=Tribonema minus Ta... [more]
A0A7S4DB68_HETAK1.140e-2057.58Hypothetical protein n=1 Tax=Heterosigma akashiwo ... [more]
A0A8J2WXW7_9STRA1.810e-1952.58Cilia- and flagella-associated protein 43 n=4 Tax=... [more]
A0A3F2RUE6_9STRA5.220e-1551.69Cilia- and flagella-associated protein 43 n=4 Tax=... [more]
A0A482S4Q2_9ARCH5.650e-1447.56Uncharacterized protein n=1 Tax=archaeon TaxID=190... [more]
A0A0P1B4M1_PLAHL8.640e-1450.56Cilia- and flagella-associated protein 43 n=1 Tax=... [more]

Pages

back to top