prot_H-canaliculatus_M_contigs9745.1.1 (polypeptide) Hapterophycus canaliculatus Oshoro7m male

You are viewing a polypeptide, more information available on the corresponding mRNA page

InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro7m male
Date Performed: 2022-09-29
ZOOM
x 1
POSITION
0
MSATTSTTPDKAGAVIVGGGPSGLATALMLAKRGWTDISVIERTASADFFDPRVAFV*510152025303540455055Expect = 4.9E-7 / Score = 29.7Expect = 9.9E-9 / Score = 36.5Score = Expect = 0.0092 / Score = 12.6SequencePF01266G3DSA:3.50.50.60SSF51905PIRSR000137-2
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006076FAD dependent oxidoreductasePFAMPF01266DAOcoord: 15..44
e-value: 4.9E-7
score: 29.7
IPR036188FAD/NAD(P)-binding domain superfamilyGENE3D3.50.50.60coord: 1..55
e-value: 9.9E-9
score: 36.5
IPR036188FAD/NAD(P)-binding domain superfamilySUPERFAMILY51905FAD/NAD(P)-binding domaincoord: 14..48
NoneNo IPR availablePIRSRPIRSR000137-2PIRSR000137-2coord: 15..50
e-value: 0.0092
score: 12.6