prot_H-canaliculatus_F_contig1012.148.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female

You are viewing a polypeptide, more information available on the corresponding mRNA page

InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro5f female
Date Performed: 2022-09-29
ZOOM
x 1
POSITION
0
MAMDVDAGAEERKVVASASDHNNGAGGFGGRQEENGGRANGEVGVGGGVSVRRDGADEAGVFKGAPCDEIPSGDVAVLNNHHSEVFMCAWNPKYDLLASGSGDSTARIWQIPPEIRGSKVAEEASRTSMVLKHSREVGDKNKDVTTLEWNREGTLLATGSYDGVARIWSQDGALQHTLEAHEGPIFSLKWNDKGNFLLSGSSDKSAIVWDVSRGDVQQQFRFHEAPTLDVDWKDDLTFATCSTDKAIHTCVVGEEYPRQTFTGHCDEVNAIKWDPSGSLLASCSDDYTAKIWKMGQTSCVHNLQEHEKEIYTIKWSPRPEKKLLLASASFDATVKLWDVFAGKVVSTLQRHQDPVYSVAFSPSGDYLVSGSFAGHLYIWSVKDGSLVKSYQGEGDIFEVAWNFREDRIAACFSTSMVAVMDFRM*50100150200250300350400Score = 38.97Score = 37.18Score = 41.13Expect = 3.5E-6 / Score = 36.6Expect = 1.2E-4 / Score = 31.5Expect = 8.3E-10 / Score = 48.6Expect = 12.0 / Score = 10.1Expect = 8.4E-10 / Score = 48.6Expect = 5.8E-7 / Score = 39.1Expect = 7.3E-10 / Score = 48.8Expect = 47.0 / Score = 6.4Expect = 1.1E-6 / Score = 29.2Expect = 2.9E-9 / Score = 37.4Score = 14.953Score = 15.354Score = 14.352Score = 13.316Score = 11.11Score = 12.948Expect = 3.9E-6 / Score = 26.9Expect = 1.2E-133 / Score = 447.2Score = Score = Score = Score = Score = 52.203Score = SequencePR00320SM00320PF00400PS50082PS50082PS50082PS50082PS50082PS50082PF08662G3DSA:2.130.10.10PTHR22846:SF54PTHR22846PS00678PS00678PS50294SSF50978
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 197..211
score: 37.18
coord: 97..111
score: 38.97
coord: 325..339
score: 41.13
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 383..421
e-value: 47.0
score: 6.4
coord: 124..169
e-value: 1.2E-4
score: 31.5
coord: 213..251
e-value: 12.0
score: 10.1
coord: 341..380
e-value: 7.3E-10
score: 48.8
coord: 296..338
e-value: 5.8E-7
score: 39.1
coord: 171..210
e-value: 8.3E-10
score: 48.6
coord: 71..110
e-value: 3.5E-6
score: 36.6
coord: 254..293
e-value: 8.4E-10
score: 48.6
IPR001680WD40 repeatPFAMPF00400WD40coord: 78..109
e-value: 0.0014
score: 19.5
coord: 257..293
e-value: 2.9E-9
score: 37.4
coord: 173..210
e-value: 1.1E-6
score: 29.2
coord: 142..169
e-value: 2.2E-4
score: 21.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 348..389
score: 14.953
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 178..219
score: 15.354
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 261..302
score: 14.352
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 303..347
score: 13.316
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 137..169
score: 11.11
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 78..111
score: 12.948
IPR013979Translation initiation factor, beta propellor-like domainPFAMPF08662eIF2Acoord: 295..402
e-value: 3.9E-6
score: 26.9
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3D2.130.10.10coord: 67..424
e-value: 1.2E-133
score: 447.2
NoneNo IPR availablePANTHERPTHR22846:SF54WD40 REPEAT-CONTAINING PROTEIN HOS15coord: 57..424
NoneNo IPR availablePANTHERPTHR22846WD40 REPEAT PROTEINcoord: 57..424
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 197..211
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 325..339
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 78..389
score: 52.203
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILY50978WD40 repeat-likecoord: 75..421