prot_H-canaliculatus_F_contig11607.1413.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: A0A6H5K059_9PHAE (G domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5K059_9PHAE) HSP 1 Score: 99.8 bits (247), Expect = 3.730e-23 Identity = 52/54 (96.30%), Postives = 52/54 (96.30%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNKVRA 54 MVKATKVIREKLKQVDMVFEVRDARIPFTSAN DLDKIVGPSKARLIVLNK RA Sbjct: 78 MVKATKVIREKLKQVDMVFEVRDARIPFTSANQDLDKIVGPSKARLIVLNKARA 131
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: UPI000FD984F0 (ribosome biogenesis GTPase YlqF n=1 Tax=Halobacteriovorax sp. HLS TaxID=2234000 RepID=UPI000FD984F0) HSP 1 Score: 64.3 bits (155), Expect = 9.090e-11 Identity = 33/55 (60.00%), Postives = 42/55 (76.36%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNKVRAS 55 M KATK + KLK VD+V E+RDARIP S N+DL K++G +K+RLIVLNK+ S Sbjct: 32 MAKATKQVSNKLKMVDIVLEIRDARIPLLSGNEDLKKLIG-TKSRLIVLNKMNLS 85
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: A0A1L8I540_9BACI (Ribosome biogenesis GTPase A n=1 Tax=Bacillaceae bacterium G1 TaxID=1836462 RepID=A0A1L8I540_9BACI) HSP 1 Score: 62.8 bits (151), Expect = 3.210e-10 Identity = 31/51 (60.78%), Postives = 41/51 (80.39%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNK 51 M KAT++IRE+LKQVD+VFE+ DARIP +S N +D I+GP K RL++ NK Sbjct: 11 MAKATRLIRERLKQVDVVFELLDARIPSSSRNPQIDAIIGP-KPRLVIFNK 60
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: A0A1Y5FCY6_9PROT (Ribosome biogenesis GTPase A n=1 Tax=Halobacteriovorax marinus TaxID=97084 RepID=A0A1Y5FCY6_9PROT) HSP 1 Score: 62.0 bits (149), Expect = 5.350e-10 Identity = 33/52 (63.46%), Postives = 39/52 (75.00%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNKV 52 M KAT+ + KLK VD+V E+RDARIP S NDDL +VG +K RLIVLNKV Sbjct: 1 MAKATRQVSGKLKMVDIVLEIRDARIPLLSGNDDLKSLVG-NKCRLIVLNKV 51
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: A0A2G8HQV5_9PROT (Ribosome biogenesis GTPase A n=1 Tax=Halobacteriovorax sp. JY17 TaxID=2014617 RepID=A0A2G8HQV5_9PROT) HSP 1 Score: 62.0 bits (149), Expect = 6.310e-10 Identity = 32/55 (58.18%), Postives = 41/55 (74.55%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNKVRAS 55 M KA K + +KLK VD++ E+RDARIP S N+DL K+VG +K RL+VLNKV S Sbjct: 32 MAKAMKQVGDKLKMVDIILELRDARIPLLSGNEDLKKLVG-NKCRLVVLNKVNLS 85
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: E1WXC8_HALMS (Ribosome biogenesis GTPase A n=2 Tax=Halobacteriovorax marinus TaxID=97084 RepID=E1WXC8_HALMS) HSP 1 Score: 62.0 bits (149), Expect = 6.760e-10 Identity = 33/52 (63.46%), Postives = 40/52 (76.92%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNKV 52 M KA K + EKLK VD+V E+RDARIP S N+DL K++G +K RLIVLNKV Sbjct: 51 MAKAMKQVGEKLKMVDIVLELRDARIPLLSGNEDLKKVLG-NKCRLIVLNKV 101
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: A0A7X6YBQ8_9FIRM (Ribosome biogenesis GTPase A n=1 Tax=Clostridia bacterium TaxID=2044939 RepID=A0A7X6YBQ8_9FIRM) HSP 1 Score: 59.3 bits (142), Expect = 5.450e-9 Identity = 31/51 (60.78%), Postives = 41/51 (80.39%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNK 51 M KA +++RE+LK VD+V E+RDARIP +S N DL+K++G K RLIVLNK Sbjct: 10 MAKAKRLLREQLKLVDVVLEIRDARIPDSSGNPDLEKLLGTRK-RLIVLNK 59
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: A0A847P9T7_9FIRM (Ribosome biogenesis GTPase A n=1 Tax=Erysipelotrichia bacterium TaxID=2184014 RepID=A0A847P9T7_9FIRM) HSP 1 Score: 58.5 bits (140), Expect = 1.070e-8 Identity = 32/51 (62.75%), Postives = 40/51 (78.43%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNK 51 M KA + +REK+K VDMV E+RDARIP +S N LD+I+G SK RLIVL+K Sbjct: 14 MTKAKREMREKIKLVDMVIEIRDARIPLSSINPLLDEIIG-SKPRLIVLSK 63
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: UPI00195A05F0 (ribosome biogenesis GTPase YlqF n=1 Tax=Clostridium sardiniense TaxID=29369 RepID=UPI00195A05F0) HSP 1 Score: 57.4 bits (137), Expect = 2.700e-8 Identity = 31/51 (60.78%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNK 51 M K + I+E LK VD V E+RDARIP +SAN D+DK+VG K RLI+LNK Sbjct: 10 MKKTQREIKENLKLVDAVIEIRDARIPASSANPDIDKLVG-DKPRLILLNK 59
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Match: A0A343JBM8_9CLOT (Ribosome biogenesis GTPase A n=1 Tax=Clostridium isatidis TaxID=182773 RepID=A0A343JBM8_9CLOT) HSP 1 Score: 57.4 bits (137), Expect = 2.710e-8 Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 0 Query: 1 MVKATKVIREKLKQVDMVFEVRDARIPFTSANDDLDKIVGPSKARLIVLNK 51 M K + I+E LK VD V E+RDARIP +SAN D+DKI G +KAR+I+LNK Sbjct: 11 MKKTQREIKENLKVVDAVIEIRDARIPRSSANPDIDKICG-NKARIILLNK 60 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig11607.1413.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro5f female
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig11607.1413.1 ID=prot_H-canaliculatus_F_contig11607.1413.1|Name=mRNA_H-canaliculatus_F_contig11607.1413.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=55bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|