prot_H-canaliculatus_F_contig11313.1188.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig11313.1188.1 vs. uniprot
Match: D7FSV8_ECTSI (Sister chromatid cohesion protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FSV8_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 5.270e-11 Identity = 30/34 (88.24%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 4 RYAPFRALLIEDVFGLLLKMPTGRRQLRTFRIAH 37 +Y FR LLIEDVFGLLLKMPTGRRQLRTFRIAH Sbjct: 701 KYVSFRPLLIEDVFGLLLKMPTGRRQLRTFRIAH 734
BLAST of mRNA_H-canaliculatus_F_contig11313.1188.1 vs. uniprot
Match: A0A6H5JLU6_9PHAE (PHD-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLU6_9PHAE) HSP 1 Score: 64.3 bits (155), Expect = 5.290e-11 Identity = 30/34 (88.24%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 4 RYAPFRALLIEDVFGLLLKMPTGRRQLRTFRIAH 37 +Y FR LLIEDVFGLLLKMPTGRRQLRTFRIAH Sbjct: 784 KYVSFRPLLIEDVFGLLLKMPTGRRQLRTFRIAH 817
BLAST of mRNA_H-canaliculatus_F_contig11313.1188.1 vs. uniprot
Match: A0A835Z2V2_9STRA (Sister chromatid cohesion protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z2V2_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 7.700e-6 Identity = 21/35 (60.00%), Postives = 29/35 (82.86%), Query Frame = 0 Query: 2 FARYAPFRALLIEDVFGLLLKMPTGRRQLRTFRIA 36 F + P R LL++D+FGLLLK+PT +RQLRTF++A Sbjct: 345 FVWHEPHRKLLLDDIFGLLLKLPTTKRQLRTFKLA 379
BLAST of mRNA_H-canaliculatus_F_contig11313.1188.1 vs. uniprot
Match: A0A024TYL2_9STRA (Sister chromatid cohesion protein n=3 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024TYL2_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 3.690e-5 Identity = 19/36 (52.78%), Postives = 28/36 (77.78%), Query Frame = 0 Query: 2 FARYAPFRALLIEDVFGLLLKMPTGRRQLRTFRIAH 37 F Y RALLI+D+F +LLK+P+ +R LRTF+++H Sbjct: 401 FLHYPTHRALLIDDIFSVLLKLPSNKRNLRTFKLSH 436
BLAST of mRNA_H-canaliculatus_F_contig11313.1188.1 vs. uniprot
Match: A0A3R6Z4N6_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A3R6Z4N6_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 3.710e-5 Identity = 19/36 (52.78%), Postives = 28/36 (77.78%), Query Frame = 0 Query: 2 FARYAPFRALLIEDVFGLLLKMPTGRRQLRTFRIAH 37 F Y RALLI+D+F +LLK+P+ +R LRTF+++H Sbjct: 423 FLHYPTHRALLIDDIFSVLLKLPSNKRNLRTFKLSH 458 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig11313.1188.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig11313.1188.1 ID=prot_H-canaliculatus_F_contig11313.1188.1|Name=mRNA_H-canaliculatus_F_contig11313.1188.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=37bpback to top |