prot_H-canaliculatus_F_contig1121.1094.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A6H5JCZ7_9PHAE (Amidase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCZ7_9PHAE) HSP 1 Score: 99.4 bits (246), Expect = 3.970e-23 Identity = 46/58 (79.31%), Postives = 54/58 (93.10%), Query Frame = 0 Query: 1 MGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASILG 58 MGAEGNMK FVD++QGE+MLP YA+LRQ+AG PN LRPALSWVLRNV+GDER+ASI+G Sbjct: 232 MGAEGNMKRFVDSIQGERMLPSYAALRQLAGFPNCLRPALSWVLRNVLGDERRASIVG 289
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: D7FZ96_ECTSI (Amidase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZ96_ECTSI) HSP 1 Score: 99.4 bits (246), Expect = 6.530e-23 Identity = 46/58 (79.31%), Postives = 54/58 (93.10%), Query Frame = 0 Query: 1 MGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASILG 58 MGAEGNMK FVD++QGE+MLP YA+LRQ+AG PN LRPALSWVLRNV+GDER+ASI+G Sbjct: 404 MGAEGNMKRFVDSIQGERMLPSYAALRQLAGFPNCLRPALSWVLRNVLGDERRASIVG 461
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A0M0J3E9_9EUKA (Amidase signature enzyme n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0J3E9_9EUKA) HSP 1 Score: 62.8 bits (151), Expect = 4.840e-10 Identity = 27/57 (47.37%), Postives = 43/57 (75.44%), Query Frame = 0 Query: 1 MGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 57 + A+GN +GF+D + GEK+ P YA L Q+A +PN++RP LS V+R+ +G+ RKA ++ Sbjct: 336 LSADGNFRGFLDGIDGEKLHPNYAFLCQVACVPNWIRPMLSAVMRHGLGEPRKADLV 392
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A7S2K5Q6_9STRA (Hypothetical protein (Fragment) n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2K5Q6_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 9.990e-8 Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 0 Query: 3 AEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 57 AEGNM+GF +AL+GE ++P Y +L + +PNFLRP +S +L DER+AS++ Sbjct: 418 AEGNMRGFTEALEGEALIPHYNTLYAASNLPNFLRPLVSLML-----DERRASLV 467
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A836CNU8_9STRA (Amidase signature domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CNU8_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 4.800e-7 Identity = 27/57 (47.37%), Postives = 42/57 (73.68%), Query Frame = 0 Query: 1 MGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 57 +G+EGNM GFV ALQGE++L Y L+ ++ +PN +RP L+ +L +++G R AS+L Sbjct: 317 LGSEGNMAGFVAALQGERLLGCYKRLKTMSDMPNIVRPLLARIL-DLLGHRRHASLL 372
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A7S3LKN9_9STRA (Hypothetical protein n=1 Tax=Aplanochytrium stocchinoi TaxID=215587 RepID=A0A7S3LKN9_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 3.330e-6 Identity = 24/55 (43.64%), Postives = 37/55 (67.27%), Query Frame = 0 Query: 3 AEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 57 AEGNM+GF++ L+GE + Y SL+Q A +PNFLRP ++ + DER+ ++ Sbjct: 36 AEGNMRGFIEGLEGEDLSAMYTSLKQAADLPNFLRPLIAAFI-----DERRGGLV 85
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A4D9D795_9STRA (Amidase domain-containing protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9D795_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 8.210e-5 Identity = 23/53 (43.40%), Postives = 36/53 (67.92%), Query Frame = 0 Query: 1 MGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERK 53 M AEG ++ ++DAL+GE M+P Y ++R A P+FLRP L L + G++R+ Sbjct: 20 MTAEGGLRSYIDALEGEAMIPMYRNIRLAACFPDFLRPLLHTALY-LTGEKRR 71
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: W7TYS1_9STRA (Amidase protein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TYS1_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 9.910e-5 Identity = 23/53 (43.40%), Postives = 36/53 (67.92%), Query Frame = 0 Query: 1 MGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERK 53 M AEG ++ ++DAL+GE M+P Y ++R A P+FLRP L L + G++R+ Sbjct: 407 MTAEGGLRSYIDALEGEAMIPMYRNIRLAACFPDFLRPLLHTALY-LTGEKRR 458 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 8
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig1121.1094.1 ID=prot_H-canaliculatus_F_contig1121.1094.1|Name=mRNA_H-canaliculatus_F_contig1121.1094.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=59bpback to top |