prot_H-canaliculatus_F_contig10986.903.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10986.903.1 vs. uniprot
Match: K9L3S4_MAGMU (Uncharacterized protein n=1 Tax=Magnusiomyces magnusii TaxID=43963 RepID=K9L3S4_MAGMU) HSP 1 Score: 56.2 bits (134), Expect = 3.380e-9 Identity = 23/47 (48.94%), Postives = 36/47 (76.60%), Query Frame = 0 Query: 1 VSDYLEFTIAIHTDSIELEGGVKLNSDMVDNKEIGKFKLEAEKDIAL 47 + DY+++ A+HTD+IE+ G+KL +M+ N EIGKFKLEA +D+ + Sbjct: 26 IKDYIKYVAAVHTDAIEMVDGMKLPDEMIHNTEIGKFKLEATRDLGI 72 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10986.903.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig10986.903.1 ID=prot_H-canaliculatus_F_contig10986.903.1|Name=mRNA_H-canaliculatus_F_contig10986.903.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=47bpback to top |