prot_H-canaliculatus_F_contig10798.744.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10798.744.1 vs. uniprot
Match: D7FS29_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FS29_ECTSI) HSP 1 Score: 81.3 bits (199), Expect = 4.590e-17 Identity = 34/40 (85.00%), Postives = 36/40 (90.00%), Query Frame = 0 Query: 1 QGPISDGTPCAGCDDRTQPVMIEPDGAWYCEACIEEFYEE 40 QGP SD TPCAGCDD+TQPV IEPDG WYCEACI+EFYEE Sbjct: 287 QGPKSDDTPCAGCDDKTQPVAIEPDGKWYCEACIQEFYEE 326 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10798.744.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig10798.744.1 ID=prot_H-canaliculatus_F_contig10798.744.1|Name=mRNA_H-canaliculatus_F_contig10798.744.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=46bpback to top |