prot_H-canaliculatus_F_contig1029.305.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig1029.305.1 vs. uniprot
Match: D7FIA2_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FIA2_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 1.300e-19 Identity = 44/57 (77.19%), Postives = 51/57 (89.47%), Query Frame = 0 Query: 1 QVVELAEEVDPVLSFFAYQPLRATAKAGDIPMFLSTKLLPRSDTELADKEEESDRSI 57 QVVELAEEVDPVL+FFAYQPLRATAK GDIPMFLSTKL+PRSD+ A ++E S+ S+ Sbjct: 56 QVVELAEEVDPVLNFFAYQPLRATAKPGDIPMFLSTKLMPRSDS--AKRDERSEGSV 110
BLAST of mRNA_H-canaliculatus_F_contig1029.305.1 vs. uniprot
Match: A0A835YKI8_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YKI8_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 1.730e-7 Identity = 25/43 (58.14%), Postives = 32/43 (74.42%), Query Frame = 0 Query: 1 QVVELAEEVDPVLSFFAYQPLRATAKAGDIPMFLSTKLLPRSD 43 Q+ +LAE+VDPVL FFA+QP+R TA IP+FLST+ L D Sbjct: 51 QLADLAEDVDPVLQFFAFQPVRPTANPAHIPLFLSTRPLAEMD 93 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig1029.305.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig1029.305.1 ID=prot_H-canaliculatus_F_contig1029.305.1|Name=mRNA_H-canaliculatus_F_contig1029.305.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=58bpback to top |