Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro5f female
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 12..22 |
| None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 70..101 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..29 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 30..44 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..11 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 23..29 |
| None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 45..69 |
| None | No IPR available | TMHMM | TMhelix | | coord: 50..72 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig10129.154.1 ID=prot_H-canaliculatus_F_contig10129.154.1|Name=mRNA_H-canaliculatus_F_contig10129.154.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=102bp
MRFVKRKPMMYTSAAISAAIAVRASLFYGNKPSYYSSFSGGHQCFYWNDV
LLSVSLLGVLGVPLVLLGAQLVQVNDAFKVGEEIVQVAVGCTLCQCCWSR
W* back to top
|