mRNA_H-canaliculatus_F_contig1145.1283.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig1145.1283.1 vs. uniprot
Match: D8LJV4_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LJV4_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 1.020e-9 Identity = 31/38 (81.58%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 325 MLSSVLKGFKPTFTYGSIFTGFAVDRVPMHKADEVSVE 438 MLSSVLKG+KPTFTY SIFTGFAVDRVPM KADE+ ++ Sbjct: 1 MLSSVLKGYKPTFTYSSIFTGFAVDRVPMQKADEIRLD 38
BLAST of mRNA_H-canaliculatus_F_contig1145.1283.1 vs. uniprot
Match: A0A835ZJ29_9STRA (Uncharacterized protein n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZJ29_9STRA) HSP 1 Score: 62.0 bits (149), Expect = 4.700e-7 Identity = 28/42 (66.67%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 280 ESYIVILQPTVTPYEMLSSVLKGFKPTFTYGSIFTGFAVDRV 405 ++YIVILQPTV P E+L++VLKG KP F YG+IF GF+VDR+ Sbjct: 25 DNYIVILQPTVKPDEILNTVLKGHKPGFVYGTIFVGFSVDRL 66 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig1145.1283.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig1145.1283.1 >prot_H-canaliculatus_F_contig1145.1283.1 ID=prot_H-canaliculatus_F_contig1145.1283.1|Name=mRNA_H-canaliculatus_F_contig1145.1283.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=81bp MANGPRSGRSSRPHRPPPPTVAEKRIPESYIVILQPTVTPYEMLSSVLKGback to top mRNA from alignment at H-canaliculatus_F_contig1145:26811..27778+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig1145.1283.1 ID=mRNA_H-canaliculatus_F_contig1145.1283.1|Name=mRNA_H-canaliculatus_F_contig1145.1283.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=968bp|location=Sequence derived from alignment at H-canaliculatus_F_contig1145:26811..27778+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig1145:26811..27778+ >mRNA_H-canaliculatus_F_contig1145.1283.1 ID=mRNA_H-canaliculatus_F_contig1145.1283.1|Name=mRNA_H-canaliculatus_F_contig1145.1283.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=486bp|location=Sequence derived from alignment at H-canaliculatus_F_contig1145:26811..27778+ (Hapterophycus canaliculatus Oshoro5f female)back to top |