mRNA_H-canaliculatus_F_contig1121.1094.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A6H5JCZ7_9PHAE (Amidase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JCZ7_9PHAE) HSP 1 Score: 108 bits (271), Expect = 1.360e-26 Identity = 50/62 (80.65%), Postives = 58/62 (93.55%), Query Frame = 1 Query: 1 YYGQMGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASILG 186 YYGQMGAEGNMK FVD++QGE+MLP YA+LRQ+AG PN LRPALSWVLRNV+GDER+ASI+G Sbjct: 228 YYGQMGAEGNMKRFVDSIQGERMLPSYAALRQLAGFPNCLRPALSWVLRNVLGDERRASIVG 289
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: D7FZ96_ECTSI (Amidase domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZ96_ECTSI) HSP 1 Score: 108 bits (271), Expect = 3.060e-26 Identity = 50/62 (80.65%), Postives = 58/62 (93.55%), Query Frame = 1 Query: 1 YYGQMGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASILG 186 YYGQMGAEGNMK FVD++QGE+MLP YA+LRQ+AG PN LRPALSWVLRNV+GDER+ASI+G Sbjct: 400 YYGQMGAEGNMKRFVDSIQGERMLPSYAALRQLAGFPNCLRPALSWVLRNVLGDERRASIVG 461
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A0M0J3E9_9EUKA (Amidase signature enzyme n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0J3E9_9EUKA) HSP 1 Score: 64.3 bits (155), Expect = 1.630e-10 Identity = 28/61 (45.90%), Postives = 44/61 (72.13%), Query Frame = 1 Query: 1 YYGQMGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 183 Y + A+GN +GF+D + GEK+ P YA L Q+A +PN++RP LS V+R+ +G+ RKA ++ Sbjct: 332 YVALLSADGNFRGFLDGIDGEKLHPNYAFLCQVACVPNWIRPMLSAVMRHGLGEPRKADLV 392
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A836CNU8_9STRA (Amidase signature domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CNU8_9STRA) HSP 1 Score: 63.9 bits (154), Expect = 2.280e-10 Identity = 31/61 (50.82%), Postives = 46/61 (75.41%), Query Frame = 1 Query: 1 YYGQMGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 183 YYGQ+G+EGNM GFV ALQGE++L Y L+ ++ +PN +RP L+ +L +++G R AS+L Sbjct: 313 YYGQLGSEGNMAGFVAALQGERLLGCYKRLKTMSDMPNIVRPLLARIL-DLLGHRRHASLL 372
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A7S2K5Q6_9STRA (Hypothetical protein (Fragment) n=1 Tax=Leptocylindrus danicus TaxID=163516 RepID=A0A7S2K5Q6_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 8.630e-8 Identity = 27/55 (49.09%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 19 AEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 183 AEGNM+GF +AL+GE ++P Y +L + +PNFLRP +S +L DER+AS++ Sbjct: 418 AEGNMRGFTEALEGEALIPHYNTLYAASNLPNFLRPLVSLML-----DERRASLV 467
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A7S3LKN9_9STRA (Hypothetical protein n=1 Tax=Aplanochytrium stocchinoi TaxID=215587 RepID=A0A7S3LKN9_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 1.060e-6 Identity = 27/61 (44.26%), Postives = 41/61 (67.21%), Query Frame = 1 Query: 4 YGQMG-AEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERKASIL 183 Y Q+G AEGNM+GF++ L+GE + Y SL+Q A +PNFLRP ++ + DER+ ++ Sbjct: 30 YVQLGSAEGNMRGFIEGLEGEDLSAMYTSLKQAADLPNFLRPLIAAFI-----DERRGGLV 85
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: A0A4D9D795_9STRA (Amidase domain-containing protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9D795_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 2.730e-6 Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 1 Query: 1 YYGQMGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERK 171 YY M AEG ++ ++DAL+GE M+P Y ++R A P+FLRP L L + G++R+ Sbjct: 16 YYNIMTAEGGLRSYIDALEGEAMIPMYRNIRLAACFPDFLRPLLHTALY-LTGEKRR 71
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Match: W7TYS1_9STRA (Amidase protein n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TYS1_9STRA) HSP 1 Score: 52.0 bits (123), Expect = 3.730e-6 Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 1 Query: 1 YYGQMGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDERK 171 YY M AEG ++ ++DAL+GE M+P Y ++R A P+FLRP L L + G++R+ Sbjct: 403 YYNIMTAEGGLRSYIDALEGEAMIPMYRNIRLAACFPDFLRPLLHTALY-LTGEKRR 458 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig1121.1094.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 8
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig1121.1094.1 >prot_H-canaliculatus_F_contig1121.1094.1 ID=prot_H-canaliculatus_F_contig1121.1094.1|Name=mRNA_H-canaliculatus_F_contig1121.1094.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=59bp MGAEGNMKGFVDALQGEKMLPGYASLRQIAGIPNFLRPALSWVLRNVVGDback to top mRNA from alignment at H-canaliculatus_F_contig1121:124..312+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig1121.1094.1 ID=mRNA_H-canaliculatus_F_contig1121.1094.1|Name=mRNA_H-canaliculatus_F_contig1121.1094.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=189bp|location=Sequence derived from alignment at H-canaliculatus_F_contig1121:124..312+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig1121:124..312+ >mRNA_H-canaliculatus_F_contig1121.1094.1 ID=mRNA_H-canaliculatus_F_contig1121.1094.1|Name=mRNA_H-canaliculatus_F_contig1121.1094.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=354bp|location=Sequence derived from alignment at H-canaliculatus_F_contig1121:124..312+ (Hapterophycus canaliculatus Oshoro5f female)back to top |