mRNA_H-canaliculatus_F_contig10066.97.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10066.97.1 vs. uniprot
Match: A0A6H5JY17_9PHAE (SWIM-type domain-containing protein n=3 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JY17_9PHAE) HSP 1 Score: 79.3 bits (194), Expect = 4.080e-15 Identity = 38/46 (82.61%), Postives = 42/46 (91.30%), Query Frame = 3 Query: 171 SVRARTSLEAHLELIGELPVHVAASVRYKLMPARPGHIVGFGPDGF 308 SV ARTSLEA L+LIGELPVHVAA+VRYKL PARPGH+V FGP+GF Sbjct: 311 SVWARTSLEALLDLIGELPVHVAAAVRYKLTPARPGHVVVFGPNGF 356
BLAST of mRNA_H-canaliculatus_F_contig10066.97.1 vs. uniprot
Match: A0A6H5KWR3_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KWR3_9PHAE) HSP 1 Score: 68.2 bits (165), Expect = 3.270e-11 Identity = 31/43 (72.09%), Postives = 37/43 (86.05%), Query Frame = 3 Query: 180 ARTSLEAHLELIGELPVHVAASVRYKLMPARPGHIVGFGPDGF 308 ARTSLEA L+L+ +PVH+AA+VRYKL P+RPGHIV FGP GF Sbjct: 327 ARTSLEALLDLVSRVPVHLAAAVRYKLTPSRPGHIVVFGPGGF 369
BLAST of mRNA_H-canaliculatus_F_contig10066.97.1 vs. uniprot
Match: A0A6H5L2H3_9PHAE (SWIM-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2H3_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 6.300e-11 Identity = 30/47 (63.83%), Postives = 39/47 (82.98%), Query Frame = 3 Query: 168 HSVRARTSLEAHLELIGELPVHVAASVRYKLMPARPGHIVGFGPDGF 308 ++V ARTSLEA L+L+ +PVH+AA+VRYKL P+RPGH+V GP GF Sbjct: 267 NTVWARTSLEAPLDLVSRVPVHLAAAVRYKLTPSRPGHVVVVGPGGF 313
BLAST of mRNA_H-canaliculatus_F_contig10066.97.1 vs. uniprot
Match: A0A6H5JYU5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYU5_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 1.440e-9 Identity = 29/47 (61.70%), Postives = 38/47 (80.85%), Query Frame = 1 Query: 46 ILRRKLETAHFNLNLFDEAPPDTNLEKDCMGGPEAESTDDSTAYGRA 186 +LR++LE AHF+ N+ +EAPPDT+LE DC GPEAEST D+T + RA Sbjct: 157 VLRQQLEAAHFDFNVCEEAPPDTDLEIDCKLGPEAESTGDNTVWARA 203
BLAST of mRNA_H-canaliculatus_F_contig10066.97.1 vs. uniprot
Match: A0A6H5JZB4_9PHAE (SWIM-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JZB4_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 2.530e-8 Identity = 27/46 (58.70%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 46 ILRRKLETAHFNLNLFDEAPPDTNLEKDCMGGPEAESTDDSTAYGR 183 +LR++LE AHF+ NL +E PPDT+LE DC PEAEST+D+T + R Sbjct: 716 VLRQQLEAAHFDFNLCEEGPPDTDLEIDCKLDPEAESTEDNTVWAR 761
BLAST of mRNA_H-canaliculatus_F_contig10066.97.1 vs. uniprot
Match: A0A6H5KC44_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KC44_9PHAE) HSP 1 Score: 52.0 bits (123), Expect = 1.410e-5 Identity = 21/29 (72.41%), Postives = 26/29 (89.66%), Query Frame = 3 Query: 222 LPVHVAASVRYKLMPARPGHIVGFGPDGF 308 +PVH+AA+VRYKL P+RPGH+V FGP GF Sbjct: 71 VPVHLAAAVRYKLTPSRPGHVVVFGPGGF 99 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10066.97.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 6 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig10066.97.1 >prot_H-canaliculatus_F_contig10066.97.1 ID=prot_H-canaliculatus_F_contig10066.97.1|Name=mRNA_H-canaliculatus_F_contig10066.97.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=103bp RRGRRRPPRSSGGGGILRRKLETAHFNLNLFDEAPPDTNLEKDCMGGPEAback to top mRNA from alignment at H-canaliculatus_F_contig10066:2297..2605+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig10066.97.1 ID=mRNA_H-canaliculatus_F_contig10066.97.1|Name=mRNA_H-canaliculatus_F_contig10066.97.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=309bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10066:2297..2605+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig10066:2297..2605+ >mRNA_H-canaliculatus_F_contig10066.97.1 ID=mRNA_H-canaliculatus_F_contig10066.97.1|Name=mRNA_H-canaliculatus_F_contig10066.97.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=618bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10066:2297..2605+ (Hapterophycus canaliculatus Oshoro5f female)back to top |