mRNA_H-canaliculatus_F_contig10.13.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig10.13.1 vs. uniprot
Match: D7FQZ0_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FQZ0_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 2.260e-6 Identity = 28/40 (70.00%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 202 RAEDFSGANLAALLREAGLDVLQDLEICKLVVGSGAYTDK 321 +AE FSGA+LAALLREAGLDVL+ L+ +L+VG GAYT+K Sbjct: 861 KAEGFSGADLAALLREAGLDVLRQLKSRELIVGKGAYTEK 900 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10.13.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig10.13.1 >prot_H-canaliculatus_F_contig10.13.1 ID=prot_H-canaliculatus_F_contig10.13.1|Name=mRNA_H-canaliculatus_F_contig10.13.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=118bp GAVRYHFSGIRRRPRSDRQKLGGDYHRLVRRRNTFCVLRPPIKSPQGGATback to top mRNA from alignment at H-canaliculatus_F_contig10:16254..17076+ Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig10.13.1 ID=mRNA_H-canaliculatus_F_contig10.13.1|Name=mRNA_H-canaliculatus_F_contig10.13.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=823bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10:16254..17076+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig10:16254..17076+ >mRNA_H-canaliculatus_F_contig10.13.1 ID=mRNA_H-canaliculatus_F_contig10.13.1|Name=mRNA_H-canaliculatus_F_contig10.13.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=708bp|location=Sequence derived from alignment at H-canaliculatus_F_contig10:16254..17076+ (Hapterophycus canaliculatus Oshoro5f female)back to top |