|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR002885 | Pentatricopeptide repeat | PFAM | PF13041 | PPR_2 | coord: 409..456
e-value: 8.6E-13
score: 48.3
coord: 727..772
e-value: 4.7E-9
score: 36.3 |
| IPR002885 | Pentatricopeptide repeat | TIGRFAM | TIGR00756 | TIGR00756 | coord: 624..658
e-value: 1.9E-5
score: 22.5
coord: 588..621
e-value: 4.1E-5
score: 21.5
coord: 517..551
e-value: 2.3E-8
score: 31.7
coord: 273..306
e-value: 1.3E-6
score: 26.2
coord: 202..230
e-value: 1.3E-8
score: 32.5
coord: 659..692
e-value: 1.9E-6
score: 25.6
coord: 447..480
e-value: 3.5E-7
score: 28.0
coord: 482..516
e-value: 2.7E-9
score: 34.6
coord: 237..271
e-value: 9.6E-10
score: 36.0
coord: 552..586
e-value: 8.4E-8
score: 29.9
coord: 166..199
e-value: 6.2E-7
score: 27.2
coord: 343..372
e-value: 0.0014
score: 16.7
coord: 307..340
e-value: 4.4E-7
score: 27.7
coord: 412..445
e-value: 9.5E-8
score: 29.8
coord: 378..411
e-value: 7.3E-8
score: 30.1
coord: 694..728
e-value: 5.9E-5
score: 21.0
coord: 730..764
e-value: 1.6E-7
score: 29.0 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF01535 | PPR | coord: 343..372
e-value: 0.0069
score: 16.6
coord: 378..407
e-value: 3.9E-6
score: 26.8
coord: 307..337
e-value: 1.5E-4
score: 21.8 |
| IPR002885 | Pentatricopeptide repeat | PFAM | PF13812 | PPR_3 | coord: 537..598
e-value: 4.8E-13
score: 49.0
coord: 644..705
e-value: 2.4E-12
score: 46.7
coord: 467..528
e-value: 5.9E-14
score: 51.9 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 621..656
score: 9.668 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 445..479
score: 11.641 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 129..163
score: 9.482 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 340..374
score: 10.073 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 657..691
score: 12.211 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 164..198
score: 12.09 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 692..726
score: 10.446 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 515..549
score: 13.11 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 585..619
score: 10.863 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 235..269
score: 13.099 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 199..233
score: 12.353 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 305..339
score: 11.882 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 410..444
score: 13.154 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 728..762
score: 11.433 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 375..409
score: 11.301 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 480..514
score: 12.902 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 270..304
score: 10.731 |
| IPR002885 | Pentatricopeptide repeat | PROSITE | PS51375 | PPR | coord: 550..584
score: 11.685 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 91..194
e-value: 8.1E-17
score: 63.7 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 421..525
e-value: 3.6E-38
score: 132.7
coord: 316..420
e-value: 1.5E-32
score: 114.4
coord: 200..315
e-value: 6.8E-38
score: 131.8
coord: 526..629
e-value: 1.1E-35
score: 124.7 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | | coord: 630..785
e-value: 1.1E-43
score: 151.8 |
| IPR033443 | Pentacotripeptide-repeat region of PRORP | PFAM | PF17177 | PPR_long | coord: 159..304
e-value: 1.9E-13
score: 50.3 |
| None | No IPR available | PANTHER | PTHR46128 | FAMILY NOT NAMED | coord: 234..467
coord: 516..771 |
| None | No IPR available | PANTHER | PTHR46128:SF10 | | coord: 459..630
coord: 129..388
coord: 379..550 |
| None | No IPR available | PANTHER | PTHR46128:SF10 | | coord: 234..467
coord: 516..771 |
| None | No IPR available | PANTHER | PTHR46128 | FAMILY NOT NAMED | coord: 459..630
coord: 129..388
coord: 379..550 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig1608.3522.1 ID=prot_H-paniculata_contig1608.3522.1|Name=mRNA_H-paniculata_contig1608.3522.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=791bp
MALRCVAGAGKGSTIVMRQNAGSAHSAVLARLSEYRISSAATESDTPPCS
TNRGIGRWTARHVGGGGESKGGFRRTSARGQGEVRSDVWEVRNSYLGRLK
RAGLRQNWDETSNVLKEALARNDANAVVNVYVYTAAVTAAANCARWKDAV
GMLAFMRKEGVRPNAVTYNAAITACGKCGEAARALSLFREMQQKGIAADH
WSYNSVIKACGKNGEWEQAVSLLREMREEGAAALNAVIFTSVIKACGDSG
QWEQALSIFREMQKEGIVPNVMSYTAAIKACGDGGRWEHAISLLREMQAH
CIAPDVVCYTSAIKACGDGGQWKQALSILREMQAEGIAPNPRSYATTIKA
CGDCNQWEQAVSLLREMQTEGIARHDWSYNAAIKACGDGGQWEEALSLLK
EMQMGGIAPDVVSYNSAITACGNSGQWKQALSLLREMPEKGIAPDMVSYT
SAIKACGDGGKWEQALSLLREMQKNGVNVDVVSYTSAISACGNGGQWEHA
MSLWEEMQRDGINPNAVSYSSVIKACGDCGQWEQALSLLREMQTKGVAPN
VVSYNSAITACGNNGQWEHALSLLREMQIERIAPDVMSYTSVIKTCGDCG
QWEQSLAILREMQTEGVVSPNVMSYSSAIKACGDGRQWRRALSLLREMLQ
KEGIAPDIVSYNSAIKACGNVGKWRQSLALLREMQTKGIAPTVVSYNCSI
KACGDVGRWKQSLDLLREMQSEGIATPNVVSYNSAIVACGKGGQWGKALA
LLGEMRRQSILPDVESYNSVILAMWDRGRSSRRYDSPIVS* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|