prot_H-paniculata_contig14936.2938.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14936.2938.1 vs. uniprot
Match: A0A7S4DJB2_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4DJB2_HETAK) HSP 1 Score: 48.5 bits (114), Expect = 6.500e-5 Identity = 27/88 (30.68%), Postives = 42/88 (47.73%), Query Frame = 0 Query: 1 GDVIGEDCVLGFETRQYQVVALTPRVQVCVVSRENALLYLTSGELDQLHDQTSDLYRYAGGSSKSYFKAVKGWQDATKLKLEAIGPSY 88 GD GEDCVLG+ R YQVVAL ++R + L+ +++Q+ +T LY + Y + + L+ +GP Y Sbjct: 25 GDHFGEDCVLGYNFRCYQVVALEDETVCLAINRGDIERNLSKTDIEQIRQETRALYVPDEELYRKYRQITDSQKIIAHLRNRELGPGY 112 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14936.2938.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14936.2938.1 ID=prot_H-paniculata_contig14936.2938.1|Name=mRNA_H-paniculata_contig14936.2938.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=91bpback to top |