mRNA_H-paniculata_contig14720.2821.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14720.2821.1 vs. uniprot
Match: D7G2K8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2K8_ECTSI) HSP 1 Score: 82.4 bits (202), Expect = 3.560e-17 Identity = 39/47 (82.98%), Postives = 40/47 (85.11%), Query Frame = 1 Query: 1 QVWPFSLQNDGFWEKKIDEPFLEKDRNALELLRALIRVTMMRHSKSQ 141 QVWPFSLQNDGFWEKK+ EPF KD ALELLRALI V MMRHSKSQ Sbjct: 595 QVWPFSLQNDGFWEKKVGEPFEAKDYGALELLRALIGVVMMRHSKSQ 641
BLAST of mRNA_H-paniculata_contig14720.2821.1 vs. uniprot
Match: A0A835Z4V2_9STRA (SNF2 family N-terminal domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z4V2_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 2.400e-11 Identity = 27/45 (60.00%), Postives = 36/45 (80.00%), Query Frame = 1 Query: 1 QVWPFSLQNDGFWEKKIDEPFLEKDRNALELLRALIRVTMMRHSK 135 +VWPF+LQNDGFWE+K+ PF + R+AL L+ AL+ +T MRHSK Sbjct: 368 RVWPFTLQNDGFWERKVQAPFEGRRRDALPLVHALVEITSMRHSK 412
BLAST of mRNA_H-paniculata_contig14720.2821.1 vs. uniprot
Match: A0A2V3IIE0_9FLOR (Uncharacterized protein n=1 Tax=Gracilariopsis chorda TaxID=448386 RepID=A0A2V3IIE0_9FLOR) HSP 1 Score: 52.4 bits (124), Expect = 1.370e-6 Identity = 23/47 (48.94%), Postives = 34/47 (72.34%), Query Frame = 1 Query: 1 QVWPFSLQNDGFWEKKIDEPFLEKDRNALELLRALIRVTMMRHSKSQ 141 ++WPF+L+NDGFWEK + P + R LL +L+ VTM+RH+K+Q Sbjct: 576 RIWPFTLENDGFWEKHVLGP--RRSRVGSSLLSSLLDVTMIRHTKAQ 620
BLAST of mRNA_H-paniculata_contig14720.2821.1 vs. uniprot
Match: R7QAQ4_CHOCR (Uncharacterized protein n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QAQ4_CHOCR) HSP 1 Score: 50.1 bits (118), Expect = 8.960e-6 Identity = 24/47 (51.06%), Postives = 33/47 (70.21%), Query Frame = 1 Query: 1 QVWPFSLQNDGFWEKKIDEPFLEKDRNALELLRALIRVTMMRHSKSQ 141 +VWPF+L +DGFWE+ I PF ++ A + L+ VTMMRHSK+Q Sbjct: 273 RVWPFTLFDDGFWERLIYCPFAAQESTAF--IDHLLNVTMMRHSKAQ 317 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14720.2821.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14720.2821.1 >prot_H-paniculata_contig14720.2821.1 ID=prot_H-paniculata_contig14720.2821.1|Name=mRNA_H-paniculata_contig14720.2821.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=47bp QVWPFSLQNDGFWEKKIDEPFLEKDRNALELLRALIRVTMMRHSKSQback to top mRNA from alignment at H-paniculata_contig14720:6088..6228- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14720.2821.1 ID=mRNA_H-paniculata_contig14720.2821.1|Name=mRNA_H-paniculata_contig14720.2821.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=141bp|location=Sequence derived from alignment at H-paniculata_contig14720:6088..6228- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14720:6088..6228- >mRNA_H-paniculata_contig14720.2821.1 ID=mRNA_H-paniculata_contig14720.2821.1|Name=mRNA_H-paniculata_contig14720.2821.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=282bp|location=Sequence derived from alignment at H-paniculata_contig14720:6088..6228- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |