mRNA_H-paniculata_contig14671.2792.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14671.2792.1 vs. uniprot
Match: A0A6H5JP19_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JP19_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 3.360e-9 Identity = 34/83 (40.96%), Postives = 50/83 (60.24%), Query Frame = 1 Query: 4 FWRTYGTQNIRLLSEVARNVLGAPASSASLEQDFGEAGRLINR-RGSLDPACVEMVMFLHGVYNYIPREIPKLSNDEAKDAIP 249 +WR +G ++ L VA+ V G PAS+ +E+DF A + R R SLDPA +EM ++L ++ IP +IPKL + AIP Sbjct: 530 YWRLHGKKHPFALRLVAQAVYGVPASAGVVERDFSIADLFMPRKRASLDPAYLEMQLYLRAHFDSIPMDIPKLDDASVAAAIP 612
BLAST of mRNA_H-paniculata_contig14671.2792.1 vs. uniprot
Match: A0A2S2PJQ9_SCHGA (Putative AC transposase (Fragment) n=1 Tax=Schizaphis graminum TaxID=13262 RepID=A0A2S2PJQ9_SCHGA) HSP 1 Score: 51.6 bits (122), Expect = 4.250e-6 Identity = 28/62 (45.16%), Postives = 38/62 (61.29%), Query Frame = 1 Query: 7 WRTYGTQNIRLLSEVARNVLGAPASSASLEQDFGEAGRLIN-RRGSLDPACVEMVMFLHGVY 189 W + LLS++A+ +LG PASSAS E+ F AGR+I RR +L V+ +MFLH Y Sbjct: 94 WWEQNSSRFPLLSQLAKKILGIPASSASSERCFSTAGRIIEKRRTNLKGETVDSLMFLHDHY 155
BLAST of mRNA_H-paniculata_contig14671.2792.1 vs. uniprot
Match: G4Z7A8_PHYSP (Uncharacterized protein (Fragment) n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4Z7A8_PHYSP) HSP 1 Score: 48.1 bits (113), Expect = 3.080e-5 Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = 1 Query: 37 LLSEVARNVLGAPASSASLEQDFGEAGRLINR-RGSLDPACVEMVMFLHGVYNYIPR-EIPKLSNDEAKDAIP 249 LL VAR + P+SSA +E+DFG +G+++ R S A ++M FLH +++ + PKL E + IP Sbjct: 3 LLPMVARILFAVPSSSAQIERDFGNSGKMVTALRASTSTANIDMACFLHQHRSFVDVCQCPKLKASEVDEHIP 75 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14671.2792.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14671.2792.1 >prot_H-paniculata_contig14671.2792.1 ID=prot_H-paniculata_contig14671.2792.1|Name=mRNA_H-paniculata_contig14671.2792.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=83bp TFWRTYGTQNIRLLSEVARNVLGAPASSASLEQDFGEAGRLINRRGSLDPback to top mRNA from alignment at H-paniculata_contig14671:5407..5655- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14671.2792.1 ID=mRNA_H-paniculata_contig14671.2792.1|Name=mRNA_H-paniculata_contig14671.2792.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=249bp|location=Sequence derived from alignment at H-paniculata_contig14671:5407..5655- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14671:5407..5655- >mRNA_H-paniculata_contig14671.2792.1 ID=mRNA_H-paniculata_contig14671.2792.1|Name=mRNA_H-paniculata_contig14671.2792.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=498bp|location=Sequence derived from alignment at H-paniculata_contig14671:5407..5655- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |