mRNA_H-paniculata_contig14665.2789.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Match: A0A6H5JK59_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JK59_9PHAE) HSP 1 Score: 92.0 bits (227), Expect = 5.290e-19 Identity = 37/58 (63.79%), Postives = 46/58 (79.31%), Query Frame = 2 Query: 95 EWFLMPTSWLSRWHEYILAGSGEDIDFPVPPPGPITNGDLVDAQGVPLENKAAGKHYR 268 +W+LM +WLSRWH Y+L+G+GED+DFP P PGPITNGD+VD VP+ AGKHYR Sbjct: 1175 KWYLMAGTWLSRWHAYVLSGTGEDLDFPTPSPGPITNGDIVDENLVPIPGMVAGKHYR 1232
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Match: L8H1Q6_ACACA (Ubiquitin carboxyl-terminal hydrolase n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H1Q6_ACACA) HSP 1 Score: 81.3 bits (199), Expect = 3.040e-15 Identity = 40/91 (43.96%), Postives = 50/91 (54.95%), Query Frame = 2 Query: 98 WFLMPTSWLSRWHEYILAGSGEDIDFPVPPPGPITNGDLVDAQGVPLENKAAGKHYRGAVKEVWDYLHARYGGGPVLRRNDPCGLYDVPSS 370 W+L+ SWL W ++ + + +PPPGPI N L+ G P HYRG VKEVWD+ HARYGGGP L R LY +P S Sbjct: 653 WYLISASWLQSWADFSKSRT-------MPPPGPIDNWCLLQPNGKPKPKLKCSIHYRGVVKEVWDFFHARYGGGPALLR-PTIDLYAIPRS 735
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Match: A0A812RF68_9DINO (CPK2 protein n=1 Tax=Symbiodinium natans TaxID=878477 RepID=A0A812RF68_9DINO) HSP 1 Score: 69.3 bits (168), Expect = 4.380e-11 Identity = 35/86 (40.70%), Postives = 48/86 (55.81%), Query Frame = 2 Query: 98 WFLMPTSWLSRWHEYILAGSGEDIDFPVPPPGPITNGDLVDAQGVPLENKAAGKHYRGAVKEVWDYLHARYGGGPVLRRNDPCGLY 355 WFL+ + WL RW ++ G G PGPI+N +LV A G PL +K K YR ++VW++L +YGGGP + R LY Sbjct: 57 WFLVCSQWLQRWKDF-ANGKGAL-------PGPISNCNLVGADGSPLPDKKVQKDYRAVNQKVWEFLRKQYGGGPEILRRQTMQLY 134
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Match: A0A1Q9DNS2_SYMMI (Ubiquitin carboxyl-terminal hydrolase 20 n=2 Tax=Symbiodinium TaxID=2949 RepID=A0A1Q9DNS2_SYMMI) HSP 1 Score: 68.9 bits (167), Expect = 5.800e-11 Identity = 34/79 (43.04%), Postives = 45/79 (56.96%), Query Frame = 2 Query: 98 WFLMPTSWLSRWHEYILAGSGEDIDFPVPPPGPITNGDLVDAQGVPLENKAAGKHYRGAVKEVWDYLHARYGGGPVLRR 334 W+++ T WL W +++ G PP ITN L+DA G PL +K K +RG VW YLHARYGGGP ++R Sbjct: 488 WYVICTHWLDTWKDFVRGLRG--------PPDLITNHRLMDASGSPLPDKEPLKDFRGLNFVVWRYLHARYGGGPEIKR 558
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Match: A0A813CE39_9DINO (USP20 protein n=1 Tax=Symbiodinium sp. KB8 TaxID=230985 RepID=A0A813CE39_9DINO) HSP 1 Score: 68.9 bits (167), Expect = 6.050e-11 Identity = 34/79 (43.04%), Postives = 45/79 (56.96%), Query Frame = 2 Query: 98 WFLMPTSWLSRWHEYILAGSGEDIDFPVPPPGPITNGDLVDAQGVPLENKAAGKHYRGAVKEVWDYLHARYGGGPVLRR 334 W+++ T WL W +++ G PP ITN L+DA G PL +K K +RG VW YLHARYGGGP ++R Sbjct: 488 WYVICTHWLDTWKDFVRGLRG--------PPDLITNHRLMDASGSPLPDKEPLKDFRGLNFVVWRYLHARYGGGPEIKR 558
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Match: A0A7S0F5J9_9CRYP (Hypothetical protein n=1 Tax=Hanusia phi TaxID=3032 RepID=A0A7S0F5J9_9CRYP) HSP 1 Score: 62.0 bits (149), Expect = 1.540e-8 Identity = 30/81 (37.04%), Postives = 42/81 (51.85%), Query Frame = 2 Query: 98 WFLMPTSWLSRWHEYILAGSGEDIDFPVPPPGPITNGDLVDAQGV-PLENKAAGKHYRGAVKEVWDYLHARYGGGPVLRRN 337 W+++ WL W ++ + PGPI+N DL+D GV P G HYRG K+VWD + YGGGP + R+ Sbjct: 498 WYIIDKKWLQSWLSFVHQDQLGAV------PGPISNADLLDKDGVTPKTGLEKGTHYRGVNKQVWDIFFSIYGGGPPIIRS 572
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Match: A0A812LCB3_9DINO (Hypothetical protein n=1 Tax=Symbiodinium sp. CCMP2592 TaxID=631055 RepID=A0A812LCB3_9DINO) HSP 1 Score: 62.0 bits (149), Expect = 1.600e-8 Identity = 30/78 (38.46%), Postives = 46/78 (58.97%), Query Frame = 2 Query: 101 FLMPTSWLSRWHEYILAGSGEDIDFPVPPPGPITNGDLVDAQGVPLENKAAGKHYRGAVKEVWDYLHARYGGGPVLRR 334 FL+ + WL +W +++ + PPGPI+N +L+ A G P NK K YRG ++VW + +RYGGGP ++R Sbjct: 519 FLLCSQWL-QWKDFLRTKTS--------PPGPISNHNLIGADGFPKPNKQPIKDYRGVKEKVWKFWLSRYGGGPEIKR 587 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14665.2789.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14665.2789.1 >prot_H-paniculata_contig14665.2789.1 ID=prot_H-paniculata_contig14665.2789.1|Name=mRNA_H-paniculata_contig14665.2789.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=113bp RYSRGRERREGRGGRRGAQRLRGGRRRRCGGRVVPYAHILAEPLARVYSRback to top mRNA from alignment at H-paniculata_contig14665:887..6400+ Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14665.2789.1 ID=mRNA_H-paniculata_contig14665.2789.1|Name=mRNA_H-paniculata_contig14665.2789.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=5514bp|location=Sequence derived from alignment at H-paniculata_contig14665:887..6400+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14665:887..6400+ >mRNA_H-paniculata_contig14665.2789.1 ID=mRNA_H-paniculata_contig14665.2789.1|Name=mRNA_H-paniculata_contig14665.2789.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=678bp|location=Sequence derived from alignment at H-paniculata_contig14665:887..6400+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |