prot_H-paniculata_contig14478.2689.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14478.2689.1 vs. uniprot
Match: A0A6H5KG66_9PHAE (PH domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KG66_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 1.120e-6 Identity = 28/37 (75.68%), Postives = 30/37 (81.08%), Query Frame = 0 Query: 1 MKVHRFREMCRGGSCVTVWKRWAIAADALEELYPGLS 37 MKVHR+RE+CR GSCV KRWA AADALEEL PG S Sbjct: 727 MKVHRYREICRPGSCVAFRKRWAYAADALEELCPGAS 763
BLAST of mRNA_H-paniculata_contig14478.2689.1 vs. uniprot
Match: D8LCW3_ECTSI (PH domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCW3_ECTSI) HSP 1 Score: 62.0 bits (149), Expect = 1.130e-6 Identity = 28/37 (75.68%), Postives = 30/37 (81.08%), Query Frame = 0 Query: 1 MKVHRFREMCRGGSCVTVWKRWAIAADALEELYPGLS 37 MKVHR+RE+CR GSCV KRWA AADALEEL PG S Sbjct: 762 MKVHRYREICRPGSCVAFRKRWAYAADALEELCPGAS 798 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14478.2689.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14478.2689.1 ID=prot_H-paniculata_contig14478.2689.1|Name=mRNA_H-paniculata_contig14478.2689.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=382bpback to top |