prot_H-paniculata_contig14438.2666.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14438.2666.1 vs. uniprot
Match: D7FP83_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FP83_ECTSI) HSP 1 Score: 85.9 bits (211), Expect = 1.510e-18 Identity = 43/53 (81.13%), Postives = 48/53 (90.57%), Query Frame = 0 Query: 29 DAAGDNTFFESVKTSLPGLDMFDPSVFDIRMVLAVLVAVALVAYAVFRLFVRK 81 D AG+ TFFESVKTSLPGLDMFDPSVFDIRMV+ VL V+L+AYA+FRLFVRK Sbjct: 14 DTAGEGTFFESVKTSLPGLDMFDPSVFDIRMVMGVLACVSLLAYAIFRLFVRK 66
BLAST of mRNA_H-paniculata_contig14438.2666.1 vs. uniprot
Match: A0A835Z738_9STRA (Pre protein translocase subunit Sec66-domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z738_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 8.840e-7 Identity = 26/45 (57.78%), Postives = 34/45 (75.56%), Query Frame = 0 Query: 37 FESVKTSLPGLDMFDPSVFDIRMVLAVLVAVALVAYAVFRLFVRK 81 FE +KTSLP LD+FDPSVFD+RMVL L L++Y +RL++ K Sbjct: 31 FEDIKTSLPRLDIFDPSVFDMRMVLGALTLFGLLSYFAYRLYMNK 75 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14438.2666.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14438.2666.1 ID=prot_H-paniculata_contig14438.2666.1|Name=mRNA_H-paniculata_contig14438.2666.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=82bpback to top |