mRNA_H-paniculata_contig140.2447.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5KFZ4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFZ4_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 6.370e-12 Identity = 30/50 (60.00%), Postives = 40/50 (80.00%), Query Frame = 2 Query: 596 GVLCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 G C++AGDEET+RF+Y L++ +P Y+ +R Y GDWHLLLHM KAL+RR Sbjct: 605 GAPCIIAGDEETYRFIYHLMKQDPDNYRQIRRYPGDWHLLLHMAKALLRR 654
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5KK93_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KK93_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 6.850e-12 Identity = 30/50 (60.00%), Postives = 40/50 (80.00%), Query Frame = 2 Query: 596 GVLCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 G C++AGDEET+RF+Y L++ +P Y+ +R Y GDWHLLLHM KAL+RR Sbjct: 903 GAPCIIAGDEETYRFIYHLMKQDPDNYRQIRRYPGDWHLLLHMAKALLRR 952
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5KEL8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEL8_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 1.560e-11 Identity = 30/55 (54.55%), Postives = 40/55 (72.73%), Query Frame = 2 Query: 581 DERGRGVLCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 D G C++AGDEET+RF+Y L++ P Y+ +R Y GDWHLLLHM KAL++R Sbjct: 694 DAGNDGAPCIIAGDEETYRFIYHLMKQGPDNYRQIRRYPGDWHLLLHMAKALLKR 748
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5K3J0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3J0_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 1.400e-8 Identity = 26/50 (52.00%), Postives = 36/50 (72.00%), Query Frame = 2 Query: 596 GVLCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 G C++AGDEET+R +Y + + Y+ +R Y GDWHLLLHM KAL++R Sbjct: 198 GAPCIIAGDEETYRVLYHIQKQERMAYRQLRRYPGDWHLLLHMAKALLKR 247
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5KL66_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL66_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 1.670e-8 Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 2 Query: 608 VVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 +V GDEET+R M L +GNP KY+WM + G WH++LHM KALI R Sbjct: 109 LVEGDEETYRIMVQLKKGNPEKYKWMLPHPGGWHIMLHMTKALISR 154
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5LAS0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LAS0_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 1.820e-8 Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 2 Query: 608 VVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 +V GDEET+R M L +GNP KY+WM + G WH++LHM KALI R Sbjct: 1419 LVEGDEETYRIMVQLKKGNPEKYKWMLPHPGGWHIMLHMTKALISR 1464
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5K6J4_9PHAE (Uncharacterized protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K6J4_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 2.330e-8 Identity = 25/50 (50.00%), Postives = 36/50 (72.00%), Query Frame = 2 Query: 596 GVLCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 G ++ GDEET++ MY ++ P +Y+ +R Y GDWHLLLHM KA++RR Sbjct: 115 GAPFILGGDEETYKHMYHVMAQEPREYRQVRRYPGDWHLLLHMAKAMLRR 164
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: D7FTC0_ECTSI (Similar to solute carrier family 35, member F4 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTC0_ECTSI) HSP 1 Score: 64.7 bits (156), Expect = 3.150e-8 Identity = 30/59 (50.85%), Postives = 39/59 (66.10%), Query Frame = 2 Query: 578 VDERGRGV---LCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 VD R R L +V GDEET+R M L +GNP KY+WM + G WH++LH+ KAL+ R Sbjct: 348 VDGRWRSTVSRLVLVEGDEETYRIMVQLKKGNPEKYKWMVPHPGGWHIMLHVTKALMTR 406
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: A0A6H5JR31_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JR31_9PHAE) HSP 1 Score: 64.3 bits (155), Expect = 3.810e-8 Identity = 26/50 (52.00%), Postives = 35/50 (70.00%), Query Frame = 2 Query: 596 GVLCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 G C++AGDEET+R +Y + + Y+ R Y GDWHLLLHM KAL++R Sbjct: 558 GTPCIIAGDEETYRVLYHIQKQERIAYRQFRRYPGDWHLLLHMAKALLKR 607
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Match: D7FIA9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FIA9_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 6.660e-8 Identity = 25/50 (50.00%), Postives = 37/50 (74.00%), Query Frame = 2 Query: 596 GVLCVVAGDEETFRFMYDLIRGNPSKYQWMRIYVGDWHLLLHMGKALIRR 745 G ++ GDEET++ MY ++ +P +Y+ +R Y GDWHLLLHM KA++RR Sbjct: 151 GAPFILGGDEETYKHMYHVMAQDPREYRQVRRYPGDWHLLLHMAKAMLRR 200 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig140.2447.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 15
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig140.2447.1 >prot_H-paniculata_contig140.2447.1 ID=prot_H-paniculata_contig140.2447.1|Name=mRNA_H-paniculata_contig140.2447.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=170bp MTYSTRQKRERRKAETRKNEAQVALDVESMVFTWDNCDHETYRGVHGGGQback to top mRNA from alignment at H-paniculata_contig140:45902..47112+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig140.2447.1 ID=mRNA_H-paniculata_contig140.2447.1|Name=mRNA_H-paniculata_contig140.2447.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=1211bp|location=Sequence derived from alignment at H-paniculata_contig140:45902..47112+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig140:45902..47112+ >mRNA_H-paniculata_contig140.2447.1 ID=mRNA_H-paniculata_contig140.2447.1|Name=mRNA_H-paniculata_contig140.2447.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=1020bp|location=Sequence derived from alignment at H-paniculata_contig140:45902..47112+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |