mRNA_H-paniculata_contig13911.2399.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13911.2399.1 vs. uniprot
Match: A0A6H5LE02_9PHAE (DUF3668 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LE02_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 1.970e-9 Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = 1 Query: 1 RFREIQAASQKDLRGRITARIVSIGSGQSGGGGPVERERSDKNKALLEKEEYRAHIHKLARALKRHQAR 207 RFR+ Q ++ G + + +G+ ++ +ERERS KNKALLEKEEYRA+IHKLARAL+RHQ R Sbjct: 797 RFRQQQ---RRTPEGGLRQEVYRLGAAKAEAEAQIERERSLKNKALLEKEEYRANIHKLARALRRHQER 862
BLAST of mRNA_H-paniculata_contig13911.2399.1 vs. uniprot
Match: D7FXH9_ECTSI (Centrosomal protein 120 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXH9_ECTSI) HSP 1 Score: 60.1 bits (144), Expect = 9.450e-9 Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = 1 Query: 1 RFREIQAASQKDLRGRITARIVSIGSGQSGGGGPVERERSDKNKALLEKEEYRAHIHKLARALKRHQAR 207 RFR+ Q ++ G + + +G+ ++ +ERERS KNKALLEKEEYRA+IHKLARAL+ HQ R Sbjct: 1154 RFRQQQ---RRTPEGGLRQEVYRLGAAKAEAEAQIERERSLKNKALLEKEEYRANIHKLARALRHHQER 1219
BLAST of mRNA_H-paniculata_contig13911.2399.1 vs. uniprot
Match: A0A7S2SG35_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SG35_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 1.230e-5 Identity = 26/66 (39.39%), Postives = 45/66 (68.18%), Query Frame = 1 Query: 4 FREIQAASQKDLRGRITARIVSIGSGQSGGGGPVERERSDKNKALLEKEEYRAHIHKLARALKRHQ 201 F+ + A++K + A + + ++ VERER+++N+ALLEKE+Y+A++H+LARAL+R Q Sbjct: 460 FQRFREANRKTPEAALRAELARVQGEKAEVQSRVERERTERNQALLEKEQYKAYVHQLARALRREQ 525
BLAST of mRNA_H-paniculata_contig13911.2399.1 vs. uniprot
Match: A0A7S2GQT6_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2GQT6_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 6.740e-5 Identity = 27/69 (39.13%), Postives = 42/69 (60.87%), Query Frame = 1 Query: 4 FREIQAASQKDLRGRITARIVSIGSGQSGGGGPVERERSDKNKALLEKEEYRAHIHKLARALKRHQARR 210 F + A ++ + +I + ++ G +E+ER+DKN+ALL+KE+YR IH L RAL+R Q RR Sbjct: 35 FDRFRRAHRRMPEAELQTKIARLAGEKAEVEGRIEKERADKNQALLDKEKYRLQIHHLTRALQREQERR 103 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13911.2399.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13911.2399.1 >prot_H-paniculata_contig13911.2399.1 ID=prot_H-paniculata_contig13911.2399.1|Name=mRNA_H-paniculata_contig13911.2399.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=77bp RFREIQAASQKDLRGRITARIVSIGSGQSGGGGPVERERSDKNKALLEKEback to top mRNA from alignment at H-paniculata_contig13911:880..1648+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13911.2399.1 ID=mRNA_H-paniculata_contig13911.2399.1|Name=mRNA_H-paniculata_contig13911.2399.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=769bp|location=Sequence derived from alignment at H-paniculata_contig13911:880..1648+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13911:880..1648+ >mRNA_H-paniculata_contig13911.2399.1 ID=mRNA_H-paniculata_contig13911.2399.1|Name=mRNA_H-paniculata_contig13911.2399.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=462bp|location=Sequence derived from alignment at H-paniculata_contig13911:880..1648+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |