mRNA_H-paniculata_contig13858.2364.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: D7FK12_ECTSI (Outer dynein arm docking complex protein like n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FK12_ECTSI) HSP 1 Score: 87.8 bits (216), Expect = 4.540e-19 Identity = 43/47 (91.49%), Postives = 47/47 (100.00%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKMQRKN 141 QEL+HVNPPKLED+SSSEESGSDDDDARPLTR+ELKGRTLNK+QRKN Sbjct: 574 QELIHVNPPKLEDFSSSEESGSDDDDARPLTRDELKGRTLNKIQRKN 620
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: A0A7S2W848_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2W848_9STRA) HSP 1 Score: 65.5 bits (158), Expect = 2.790e-11 Identity = 30/46 (65.22%), Postives = 39/46 (84.78%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKMQRK 138 QEL+HVNPPKL+DYSS E S ++D+ RPLTR+ELK +TLN+M R+ Sbjct: 274 QELIHVNPPKLDDYSSDEGSSEEEDETRPLTRDELKAKTLNRMHRR 319
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: A0A7S3GTF5_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3GTF5_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 3.990e-10 Identity = 31/46 (67.39%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKMQRK 138 Q+LL VNPPK EDY S E G DD D RPLTR+ELK RTLNK+ +K Sbjct: 533 QDLLRVNPPKSEDYRSDESDGDDDGDTRPLTRDELKQRTLNKLTKK 578
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: A0A7S3ZW21_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S3ZW21_9STRA) HSP 1 Score: 60.8 bits (146), Expect = 1.390e-9 Identity = 30/43 (69.77%), Postives = 36/43 (83.72%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKM 129 Q+L+HVNPPKLEDYSS EE D+DD RPLTR+E+K +TL KM Sbjct: 481 QDLIHVNPPKLEDYSSEEED--DNDDTRPLTRDEIKAKTLTKM 521
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: F0Y5D3_AURAN (Uncharacterized protein (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y5D3_AURAN) HSP 1 Score: 56.6 bits (135), Expect = 4.360e-8 Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKMQRK 138 Q+L+HVNPPKLEDYSS + + RPLTR+ELK +TLN+M R+ Sbjct: 507 QDLIHVNPPKLEDYSSEXXXXXXEGETRPLTRDELKAKTLNRMYRR 552
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: A0A7S1XXH8_9STRA (Hypothetical protein n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1XXH8_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 5.960e-8 Identity = 28/45 (62.22%), Postives = 35/45 (77.78%), Query Frame = 1 Query: 4 ELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKMQRK 138 +L+HVNPPKLEDYS + G DDDD RPLTR+ELK RT N + ++ Sbjct: 535 DLIHVNPPKLEDYSEVDVDG-DDDDERPLTRDELKARTQNSISKR 578
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: K3WI31_GLOUD (Uncharacterized protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WI31_GLOUD) HSP 1 Score: 51.6 bits (122), Expect = 2.150e-7 Identity = 28/48 (58.33%), Postives = 36/48 (75.00%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEE-SGSDDDDARPLTREELKGRTLNKMQRKN 141 QE L +NPP LEDYSS +E SG ++D+ PLTR+ELK RTL ++R N Sbjct: 3 QEPLQINPPNLEDYSSEDEDSGDNEDNMHPLTRDELKVRTLKGLRRLN 50
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: A0A7S0XDM7_9STRA (Hypothetical protein n=1 Tax=Chromulina nebulosa TaxID=96789 RepID=A0A7S0XDM7_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 5.330e-7 Identity = 25/46 (54.35%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKMQRK 138 Q+ +HVNPPKL+DY+S D++ RPLT EELK +TLN++Q+K Sbjct: 491 QDYIHVNPPKLDDYNSDXXXXXXDEETRPLTLEELKMKTLNRLQKK 536
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: A0A662YF36_9STRA (Uncharacterized protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662YF36_9STRA) HSP 1 Score: 51.2 bits (121), Expect = 3.500e-6 Identity = 28/48 (58.33%), Postives = 35/48 (72.92%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSS-EESGSDDDDARPLTREELKGRTLNKMQRKN 141 QE L +NPP L+DYSS E+SG ++D PLTR+ELK RTL M+R N Sbjct: 548 QEPLQINPPNLDDYSSEGEDSGDNEDSMHPLTRDELKVRTLKGMRRLN 595
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Match: A0A5D6YBI8_9STRA (Uncharacterized protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6YBI8_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 4.780e-6 Identity = 27/46 (58.70%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 1 QELLHVNPPKLEDYSSSEE-SGSDDDDARPLTREELKGRTLNKMQR 135 QE L +NPP LEDYSS ++ SG +DD+ PLTR+ELK RTL ++R Sbjct: 528 QEPLQINPPNLEDYSSEDDDSGDNDDNMHPLTRDELKVRTLKGLRR 573 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13858.2364.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 18
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13858.2364.1 >prot_H-paniculata_contig13858.2364.1 ID=prot_H-paniculata_contig13858.2364.1|Name=mRNA_H-paniculata_contig13858.2364.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=47bp QELLHVNPPKLEDYSSSEESGSDDDDARPLTREELKGRTLNKMQRKNback to top mRNA from alignment at H-paniculata_contig13858:988..1128- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13858.2364.1 ID=mRNA_H-paniculata_contig13858.2364.1|Name=mRNA_H-paniculata_contig13858.2364.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=141bp|location=Sequence derived from alignment at H-paniculata_contig13858:988..1128- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13858:988..1128- >mRNA_H-paniculata_contig13858.2364.1 ID=mRNA_H-paniculata_contig13858.2364.1|Name=mRNA_H-paniculata_contig13858.2364.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=282bp|location=Sequence derived from alignment at H-paniculata_contig13858:988..1128- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |