mRNA_H-paniculata_contig13577.2208.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13577.2208.1 vs. uniprot
Match: D7FXH9_ECTSI (Centrosomal protein 120 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FXH9_ECTSI) HSP 1 Score: 96.3 bits (238), Expect = 1.490e-21 Identity = 50/72 (69.44%), Postives = 58/72 (80.56%), Query Frame = 2 Query: 5 WRVGEETAFATRLREKDQALEEKWAVRETARRRDMTQAQQEYGKLEGKLRKALSEVEARERGLKTREEAWRT 220 WRV EE FA RLREKD+ALE+KW RE RRR+++ AQ +Y KLEGKLRKALSEV ARER LK REE+W+T Sbjct: 1022 WRVVEEAKFAKRLREKDEALEQKWEAREATRRRELSHAQADYSKLEGKLRKALSEVGARERQLKAREESWKT 1093
BLAST of mRNA_H-paniculata_contig13577.2208.1 vs. uniprot
Match: A0A835Z851_9STRA (DUF3668 domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z851_9STRA) HSP 1 Score: 68.2 bits (165), Expect = 1.130e-11 Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = 2 Query: 5 WRVGEETAFATRLREKDQALEEKWAVRETARRRDMTQAQQEYGKLEGKLRKALSEVEAR 181 WR EE AFA +L KD ALE++WA R RRR + QAQ EY +LEGKLR+AL++VE R Sbjct: 927 WRAREEAAFARKLAAKDAALEQRWAQRXAERRRSLAQAQAEYARLEGKLRRALTDVEVR 985
BLAST of mRNA_H-paniculata_contig13577.2208.1 vs. uniprot
Match: A0A6H5LE02_9PHAE (DUF3668 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LE02_9PHAE) HSP 1 Score: 57.0 bits (136), Expect = 9.740e-8 Identity = 27/46 (58.70%), Postives = 36/46 (78.26%), Query Frame = 2 Query: 5 WRVGEETAFATRLREKDQALEEKWAVRETARRRDMTQAQQEYGKLE 142 WRV EE FA RLREKD+ALE+KW RE RRR++++AQ +Y K++ Sbjct: 716 WRVVEEDKFAKRLREKDEALEQKWEAREATRRRELSRAQADYSKVD 761 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13577.2208.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13577.2208.1 >prot_H-paniculata_contig13577.2208.1 ID=prot_H-paniculata_contig13577.2208.1|Name=mRNA_H-paniculata_contig13577.2208.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=74bp TVAGRRRDGVCHTSQREGPGLGREVGREGDCPTEGYDTSAAGVWKVGGKTback to top mRNA from alignment at H-paniculata_contig13577:2475..5562+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13577.2208.1 ID=mRNA_H-paniculata_contig13577.2208.1|Name=mRNA_H-paniculata_contig13577.2208.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=3088bp|location=Sequence derived from alignment at H-paniculata_contig13577:2475..5562+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13577:2475..5562+ >mRNA_H-paniculata_contig13577.2208.1 ID=mRNA_H-paniculata_contig13577.2208.1|Name=mRNA_H-paniculata_contig13577.2208.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=444bp|location=Sequence derived from alignment at H-paniculata_contig13577:2475..5562+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |