prot_H-paniculata_contig13531.2188.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13531.2188.1 vs. uniprot
Match: D7FQW4_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FQW4_ECTSI) HSP 1 Score: 97.4 bits (241), Expect = 4.790e-23 Identity = 45/98 (45.92%), Postives = 62/98 (63.27%), Query Frame = 0 Query: 1 LGFVLGVGTAVVLKKSSKKYAYAVGGTCALAQFLSRSDFMGCGGKLGWSKLSDDELSPCERETCPCVWRTMRILKHTIVGAVPSGAGFAAGFYGALKT 98 LGF+ G+GT V ++K ++ AYAV G AQ++SR+D +GCGGKLGW KL D +L CERE +WRT R KHT+ ++ + G+ G LK Sbjct: 114 LGFLFGLGTGVCVRKVNQNAAYAVSGALVAAQYVSRTDILGCGGKLGWPKLDDYKLRDCERENFGFIWRTGRTFKHTVQESLETCEGYVIGLAAGLKA 211 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13531.2188.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig13531.2188.1 ID=prot_H-paniculata_contig13531.2188.1|Name=mRNA_H-paniculata_contig13531.2188.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=102bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|