mRNA_H-paniculata_contig13512.2176.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13512.2176.1 vs. uniprot
Match: D7FH81_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FH81_ECTSI) HSP 1 Score: 50.8 bits (120), Expect = 7.450e-5 Identity = 24/64 (37.50%), Postives = 38/64 (59.38%), Query Frame = -2 Query: 198 YLLANVEYIKFGPEFNRRLESIVWSRRVRRILFSNGNSRKQNSMFNQPIDGVGWPASLQQLTLG 389 + + +V+ ++FG F+ LE++ W RR++ I F S FNQP++ + WP SLQ L LG Sbjct: 109 FAITDVDCLEFGGTFDGSLEAVTWPRRLKMIEFL------YTSPFNQPLELIKWPESLQHLVLG 166 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13512.2176.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig13512.2176.1 >prot_H-paniculata_contig13512.2176.1 ID=prot_H-paniculata_contig13512.2176.1|Name=mRNA_H-paniculata_contig13512.2176.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=115bp MGWLNRSPNVNCCSEAGHTTPSMGWLKILPNTNCCSEAGHATPSMGWLKFback to top mRNA from alignment at H-paniculata_contig13512:4862..5287+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig13512.2176.1 ID=mRNA_H-paniculata_contig13512.2176.1|Name=mRNA_H-paniculata_contig13512.2176.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=426bp|location=Sequence derived from alignment at H-paniculata_contig13512:4862..5287+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig13512:4862..5287+ >mRNA_H-paniculata_contig13512.2176.1 ID=mRNA_H-paniculata_contig13512.2176.1|Name=mRNA_H-paniculata_contig13512.2176.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=690bp|location=Sequence derived from alignment at H-paniculata_contig13512:4862..5287+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |