prot_H-paniculata_contig13091.1933.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13091.1933.1 vs. uniprot
Match: A0A6H5KYJ9_9PHAE (Reverse transcriptase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYJ9_9PHAE) HSP 1 Score: 58.2 bits (139), Expect = 3.250e-7 Identity = 33/74 (44.59%), Postives = 43/74 (58.11%), Query Frame = 0 Query: 1 YAVVRLFKRLGIRSMVEDGDSFTADRDYQMDIVIPAGELRGALIIAYRDESLLIDVTHADPHSVGHRIRRGGGT 74 YA+ R L ++ VE G FT +R+ MDIVI G L A YR+E +L+DVTHADP + H +R G T Sbjct: 506 YALSRALNGLCVKHDVESGAPFTGERNLSMDIVIRPGALTNASSPGYRNEGILLDVTHADPQAQVH-LRNGSAT 578 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13091.1933.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig13091.1933.1 ID=prot_H-paniculata_contig13091.1933.1|Name=mRNA_H-paniculata_contig13091.1933.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=134bpback to top |