prot_H-paniculata_contig13036.1902.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig13036.1902.1 vs. uniprot
Match: A0A6H5L245_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L245_9PHAE) HSP 1 Score: 86.7 bits (213), Expect = 1.420e-19 Identity = 34/48 (70.83%), Postives = 42/48 (87.50%), Query Frame = 0 Query: 1 GFKQCEGHPPCEICSTHTEPWCNARLFLEENMFNAHVGKSLYAMQLQR 48 G KQC G PPCE+C+THTEPWCN R++L E ++NAHVGKS+YAMQL+R Sbjct: 84 GRKQCNGRPPCELCNTHTEPWCNPRVYLGEILYNAHVGKSVYAMQLRR 131
BLAST of mRNA_H-paniculata_contig13036.1902.1 vs. uniprot
Match: D7FHD4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHD4_ECTSI) HSP 1 Score: 86.7 bits (213), Expect = 1.260e-18 Identity = 34/48 (70.83%), Postives = 42/48 (87.50%), Query Frame = 0 Query: 1 GFKQCEGHPPCEICSTHTEPWCNARLFLEENMFNAHVGKSLYAMQLQR 48 G KQC G PPCE+C+THTEPWCN R++L E ++NAHVGKS+YAMQL+R Sbjct: 481 GRKQCNGRPPCELCNTHTEPWCNPRVYLGEVLYNAHVGKSVYAMQLRR 528 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig13036.1902.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig13036.1902.1 ID=prot_H-paniculata_contig13036.1902.1|Name=mRNA_H-paniculata_contig13036.1902.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=49bpback to top |